Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA4248
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4248 rplF
Status: annotated
Amino acids: 177
Structure source: AlphaFold

GO

GO:0022625 The large subunit of a ribosome located in the cytosol. GO:0019843 Binding to a ribosomal RNA. GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome. GO:0002181 The chemical reactions and pathways resulting in the formation of a protein in the cytoplasm. This is a ribosome-mediated process in which the information in messenger RNA (mRNA) is used to specify the sequence of amino acids in the protein. GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins. GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.671

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSRVAKNPVKLPAGVEIKLAGQQLSIKGAKGALELKVHPSVEVIQDSGELRFAARNGDQQTRAMAGTTRALVNNMVVGVSQGFERKLQLVGVGYKAQAKGQVLSLSLGFSHPVDYELPAGIVAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGKGVRYADEVVRRKEAKKK

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6

GO:0022625 The large subunit of a ribosome located in the cytosol.
GO:0019843 Binding to a ribosomal RNA.
GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome.
GO:0002181 The chemical reactions and pathways resulting in the formation of a protein in the cytoplasm. This is a ribosome-mediated process in which the information in messenger RNA (mRNA) is used to specify the sequence of amino acids in the protein.
GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.

Sequence Features

Domain/signature hits from InterPro and related databases.

27 records

Show feature table

Start	End	DB	Term	Name
141	162	PRINTS	PR00059	Ribosomal protein L6 signature
141	162	InterPro	IPR019906	Ribosomal protein L6, bacterial-type
71	96	PRINTS	PR00059	Ribosomal protein L6 signature
71	96	InterPro	IPR019906	Ribosomal protein L6, bacterial-type
99	115	PRINTS	PR00059	Ribosomal protein L6 signature
99	115	InterPro	IPR019906	Ribosomal protein L6, bacterial-type
2	176	NCBIfam	TIGR03654	50S ribosomal protein L6
2	176	InterPro	IPR019906	Ribosomal protein L6, bacterial-type
83	177	Gene3D	G3DSA:3.90.930.12	-
83	177	InterPro	IPR036789	Ribosomal protein L6, alpha-beta domain superfamily
83	177	FunFam	G3DSA:3.90.930.12:FF:000001	50S ribosomal protein L6
83	177	SUPERFAMILY	SSF56053	Ribosomal protein L6
154	162	ProSitePatterns	PS00525	Ribosomal protein L6 signature 1.
154	162	InterPro	IPR002358	Ribosomal protein L6, conserved site
1	176	Hamap	MF_01365_B	50S ribosomal protein L6 [rplF].
1	176	InterPro	IPR019906	Ribosomal protein L6, bacterial-type
1	82	FunFam	G3DSA:3.90.930.12:FF:000002	50S ribosomal protein L6
1	177	PANTHER	PTHR11655	60S/50S RIBOSOMAL PROTEIN L6/L9
1	177	InterPro	IPR000702	Ribosomal protein L6
1	177	PIRSF	PIRSF002162	RPL6p_RPL6a_RPL9e_RPL9o
1	82	Gene3D	G3DSA:3.90.930.12	-
1	82	InterPro	IPR036789	Ribosomal protein L6, alpha-beta domain superfamily
1	82	SUPERFAMILY	SSF56053	Ribosomal protein L6
90	164	Pfam	PF00347	Ribosomal protein L6
90	164	InterPro	IPR020040	Ribosomal protein L6, alpha-beta domain
12	82	Pfam	PF00347	Ribosomal protein L6
12	82	InterPro	IPR020040	Ribosomal protein L6, alpha-beta domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4248	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.235
6				0.218

PA4248