Protein profile

PA4264

30S ribosomal protein S10

Genome: NC_002516.2

Gene: rpsJ PA4264 Structure source: AlphaFold UniProt Q9HWD4
Amino acids 103
Annotations 6
Features 23
PDB binders 8
Druggability 0.689

Overview

Basic information about this protein and its source genome.

Accession
PA4264
Gene
rpsJ PA4264
Status
annotated
Amino acids
103
Structure source
AlphaFold
GO
GO:0015935 The smaller of the two subunits of a ribosome. GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome. GO:0000049 Binding to a transfer RNA. GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome. GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins. GO:0003723 Binding to an RNA molecule or a portion thereof.

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
30.693
Human E-value
5.57e-08
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.689
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISLG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0015935 The smaller of the two subunits of a ribosome.
  • GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome.
  • GO:0000049 Binding to a transfer RNA.
  • GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
  • GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
  • GO:0003723 Binding to an RNA molecule or a portion thereof.

Sequence Features

Domain/signature hits from InterPro and related databases.

23 records
Show feature table
Start End DB Term Name
7 100 Pfam PF00338 Ribosomal protein S10p/S20e
7 100 InterPro IPR027486 Ribosomal protein S10 domain
3 102 Hamap MF_00508 30S ribosomal protein S10 [rpsJ].
3 102 InterPro IPR001848 Ribosomal protein S10
1 103 Gene3D G3DSA:3.30.70.600 Ribosomal protein S10 domain
1 103 InterPro IPR036838 Ribosomal protein S10 domain superfamily
4 101 NCBIfam TIGR01049 30S ribosomal protein S10
4 101 InterPro IPR001848 Ribosomal protein S10
61 75 PRINTS PR00971 Ribosomal protein S10 family signature
61 75 InterPro IPR001848 Ribosomal protein S10
40 55 PRINTS PR00971 Ribosomal protein S10 family signature
40 55 InterPro IPR001848 Ribosomal protein S10
5 18 PRINTS PR00971 Ribosomal protein S10 family signature
5 18 InterPro IPR001848 Ribosomal protein S10
29 44 ProSitePatterns PS00361 Ribosomal protein S10 signature.
29 44 InterPro IPR018268 Ribosomal protein S10, conserved site
6 101 SUPERFAMILY SSF54999 Ribosomal protein S10
6 101 InterPro IPR036838 Ribosomal protein S10 domain superfamily
1 102 FunFam G3DSA:3.30.70.600:FF:000001 30S ribosomal protein S10
2 101 PANTHER PTHR11700 30S RIBOSOMAL PROTEIN S10 FAMILY MEMBER
2 101 InterPro IPR001848 Ribosomal protein S10
7 101 SMART SM01403 Ribosomal_S10_2
7 101 InterPro IPR027486 Ribosomal protein S10 domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4264
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.689
3 0.481

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
GUN P0A7R5 151.1 Da LogP -0.77 TPSA 100.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)C(=O)NC(=N2)N
NHE P0A7R5 207.3 Da LogP 0.80 TPSA 66.4 ✓ Ro5 ✓ Clean C1CCC(CC1)NCCS(=O)(=O)O
OHX Q5SHN7 286.4 Da LogP -3.55 TPSA 156.1 1 viol. ✓ Clean N[Os](N)(N)(N)(N)N
PAR Q5SHN7 615.6 Da LogP -8.86 TPSA 347.3 3 viol. ✓ Clean C1[C@H]([C@@H]([C@H]([C@@H]([C@H]1N)O[C@@H]2[C@…
PCY Q5SHN7 558.6 Da LogP 0.75 TPSA 194.7 2 viol. ✓ Clean Cc1cccc(c1C(=O)OC[C@]2([C@H]([C@@H]([C@]([C@@]2…
PUT P0A7R5 88.2 Da LogP -0.32 TPSA 52.0 ✓ Ro5 ✓ Clean C(CCN)CN
TAC Q5SHN7 444.4 Da LogP -0.21 TPSA 181.6 1 viol. ✓ Clean C[C@]1(c2cccc(c2C(=O)C3=C([C@]4([C@@H](C[C@@H]3…
WO2 Q5SHN7 [O][W]1234O[W]567(O[W]89%10(O5[P]5%11O%12[W]%13…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.