Protein target profile

PA4267

30S ribosomal protein S7

Genome: NC_002516.2

Gene: rpsG PA4267 3D evidence: AlphaFold DB model UniProt Q9HWD1
Export view
Length 156
Pocket druggability 0.714
Ligand records 57
EC / GO 0 / 9
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

4 signals

Strengths

Strong predicted binding pocket FPocket selected-pocket score 0.71. This is a computational pocket signal, not binding validation. Structure available AlphaFold DB model Ligand evidence via structure/bioactivity 4 structural and 3 bioactivity records.

Risks / watch

Human similarity Top human hit identity: 31.757%.

Missing evidence

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein.
How to read this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Overview

Basic information about this protein and its source genome.

Accession
PA4267
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
rpsG PA4267
Status
annotated
Amino acids
156
3D evidence
AlphaFold DB model
GO
GO:0022627 The small subunit of a ribosome located in the cytosol. GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins. GO:0003729 Binding to messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns. GO:0019843 Binding to a ribosomal RNA. GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome. GO:0000049 Binding to a transfer RNA.

Target profile

Computed evidence for target prioritization.

Human off-target
Hit
Human identity (%)
31.757
Human E-value
5.94e-07
Gut microbiome off-target
Hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected pocket evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.714
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MPRRRVAAKREVLADPKYGSQILAKFMNHVMESGKKAVAERIVYGALDKVKERGKADPLETFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDFARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

9 GO

Gene Ontology (GO)

9
  • GO:0022627 The small subunit of a ribosome located in the cytosol.
  • GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
  • GO:0003729 Binding to messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
  • GO:0019843 Binding to a ribosomal RNA.
  • GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome.
  • GO:0000049 Binding to a transfer RNA.
  • GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
  • GO:0015935 The smaller of the two subunits of a ribosome.
  • GO:0003723 Binding to an RNA molecule or a portion thereof.

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
20 46 ProSitePatterns PS00052 Ribosomal protein S7 signature.
20 46 InterPro IPR020606 Ribosomal protein S7, conserved site
6 149 SUPERFAMILY SSF47973 Ribosomal protein S7
6 149 InterPro IPR036823 Ribosomal protein S7 domain superfamily
1 149 Pfam PF00177 Ribosomal protein S7p/S5e
1 149 InterPro IPR023798 Ribosomal protein S7 domain
2 156 PIRSF PIRSF002122 RPS7p_RPS7a_RPS5e_RPS7o
2 156 InterPro IPR000235 Ribosomal protein S5/S7
1 156 Hamap MF_00480_B 30S ribosomal protein S7 [rpsG].
1 156 InterPro IPR005717 Ribosomal protein S7, bacterial/organellar-type
12 149 CDD cd14869 uS7_Bacteria
8 148 PANTHER PTHR11205 RIBOSOMAL PROTEIN S7
8 148 InterPro IPR000235 Ribosomal protein S5/S7
1 155 FunFam G3DSA:1.10.455.10:FF:000001 30S ribosomal protein S7
3 155 NCBIfam TIGR01029 30S ribosomal protein S7
3 155 InterPro IPR005717 Ribosomal protein S7, bacterial/organellar-type
1 155 Gene3D G3DSA:1.10.455.10 Ribosomal protein S7 domain
1 155 InterPro IPR036823 Ribosomal protein S7 domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB PA4267
AlphaFold DB — — full sequence — Viewing
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #4
0.714
Show in viewer
Site 2 FPocket #1
0.602
Show in viewer

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

57 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 57 via homologs
Structural ligands 4 0 loaded crystals
Bioactive compounds 3 50 ZINC proposed compounds
Drug-like & clean 0 1 PAINS alerts
Best available ligand signal
PAR PDB via homolog 615.6 Da · LogP -8.86 · TPSA 347.3 Open detail RCSB PDB
Detail RCSB PDB PAR PDB via homolog
Detail RCSB PDB PCY PDB via homolog
Detail RCSB PDB TAC PDB via homolog
Detail RCSB PDB WO2 PDB via homolog

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
PAR RCSB PDB
4KHP
P17291 615.6 Da LogP -8.86 TPSA 347.3 3 viol. ✓ Clean C1[C@H]([C@@H]([C@H]([C@@H]([C@H]1N)O[C@@H]2[C@…
PCY RCSB PDB
4KHP
P17291 558.6 Da LogP 0.75 TPSA 194.7 2 viol. ✓ Clean Cc1cccc(c1C(=O)OC[C@]2([C@H]([C@@H]([C@]([C@@]2…
TAC RCSB PDB
1I97
P17291 444.4 Da LogP -0.21 TPSA 181.6 1 viol. ✓ Clean C[C@]1(c2cccc(c2C(=O)C3=C([C@]4([C@@H](C[C@@H]3…
WO2 RCSB PDB
1I94
P17291 — — — [O][W]1234O[W]567(O[W]89%10(O5[P]5%11O%12[W]%13…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.