Overview
Basic information about this protein and its source genome.
- Accession
- PA4276
- Gene
- secE PA4276
- Status
- annotated
- Amino acids
- 122
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNAKAEAKESRFDLLKWLLVAVLVVVAVVGNQYFSAQPILYRVLGILVLAVIAAFLALQTAKGQAFFSLAKEARVEIRKVVWPSRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMIVG
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
8- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0008320 Enables the transfer of a protein from one side of a membrane to the other.
- GO:0065002 The directed movement of proteins in a cell, from one side of a membrane to another by means of some agent such as a transporter or pore.
- GO:0009306 The controlled release of proteins from a cell.
- GO:0006605 The process of targeting specific proteins to particular regions of the cell, typically membrane-bounded subcellular organelles. Usually requires an organelle specific protein sequence motif.
- GO:0043952 The process in which unfolded proteins are transported across the cytoplasmic membrane in Gram-positive and Gram-negative bacteria by the Sec complex, in a process involving proteolytic cleavage of an N-terminal signal peptide.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0006886 The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 59 | 92 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 22 | 122 | PANTHER | PTHR33910 | PROTEIN TRANSLOCASE SUBUNIT SECE |
| 22 | 122 | InterPro | IPR005807 | SecE subunit of protein translocation complex, bacterial-like |
| 39 | 58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 63 | 120 | Gene3D | G3DSA:1.20.5.1030 | Preprotein translocase secy subunit |
| 63 | 120 | InterPro | IPR038379 | SecE superfamily |
| 14 | 33 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 118 | 122 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 87 | 107 | PRINTS | PR01650 | Bacterial translocase SecE signature |
| 87 | 107 | InterPro | IPR005807 | SecE subunit of protein translocation complex, bacterial-like |
| 42 | 63 | PRINTS | PR01650 | Bacterial translocase SecE signature |
| 42 | 63 | InterPro | IPR005807 | SecE subunit of protein translocation complex, bacterial-like |
| 63 | 83 | PRINTS | PR01650 | Bacterial translocase SecE signature |
| 63 | 83 | InterPro | IPR005807 | SecE subunit of protein translocation complex, bacterial-like |
| 107 | 122 | PRINTS | PR01650 | Bacterial translocase SecE signature |
| 107 | 122 | InterPro | IPR005807 | SecE subunit of protein translocation complex, bacterial-like |
| 34 | 38 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 93 | 117 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 13 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 95 | 117 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 70 | 121 | Pfam | PF00584 | SecE/Sec61-gamma subunits of protein translocation complex |
| 70 | 121 | InterPro | IPR001901 | Protein translocase complex, SecE/Sec61-gamma subunit |
| 69 | 97 | ProSitePatterns | PS01067 | Protein secE/sec61-gamma signature. |
| 69 | 97 | InterPro | IPR001901 | Protein translocase complex, SecE/Sec61-gamma subunit |
| 66 | 122 | NCBIfam | TIGR00964 | preprotein translocase subunit SecE |
| 66 | 122 | InterPro | IPR005807 | SecE subunit of protein translocation complex, bacterial-like |
| 12 | 34 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 61 | 120 | Hamap | MF_00422 | Protein translocase subunit SecE [secE]. |
| 61 | 120 | InterPro | IPR001901 | Protein translocase complex, SecE/Sec61-gamma subunit |
| 39 | 58 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4276
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.766 | ||||||
| 3 | 0.296 |