Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA4276
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: secE PA4276
Status: annotated
Amino acids: 122
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0008320 Enables the transfer of a protein from one side of a membrane to the other. GO:0065002 The directed movement of proteins in a cell, from one side of a membrane to another by means of some agent such as a transporter or pore. GO:0009306 The controlled release of proteins from a cell. GO:0006605 The process of targeting specific proteins to particular regions of the cell, typically membrane-bounded subcellular organelles. Usually requires an organelle specific protein sequence motif. GO:0043952 The process in which unfolded proteins are transported across the cytoplasmic membrane in Gram-positive and Gram-negative bacteria by the Sec complex, in a process involving proteolytic cleavage of an N-terminal signal peptide.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.766

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MNAKAEAKESRFDLLKWLLVAVLVVVAVVGNQYFSAQPILYRVLGILVLAVIAAFLALQTAKGQAFFSLAKEARVEIRKVVWPSRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMIVG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

8 GO

Gene Ontology (GO)

8

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0008320 Enables the transfer of a protein from one side of a membrane to the other.
GO:0065002 The directed movement of proteins in a cell, from one side of a membrane to another by means of some agent such as a transporter or pore.
GO:0009306 The controlled release of proteins from a cell.
GO:0006605 The process of targeting specific proteins to particular regions of the cell, typically membrane-bounded subcellular organelles. Usually requires an organelle specific protein sequence motif.
GO:0043952 The process in which unfolded proteins are transported across the cytoplasmic membrane in Gram-positive and Gram-negative bacteria by the Sec complex, in a process involving proteolytic cleavage of an N-terminal signal peptide.
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
GO:0006886 The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.

Sequence Features

Domain/signature hits from InterPro and related databases.

30 records

Show feature table

Start	End	DB	Term	Name
59	92	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
22	122	PANTHER	PTHR33910	PROTEIN TRANSLOCASE SUBUNIT SECE
22	122	InterPro	IPR005807	SecE subunit of protein translocation complex, bacterial-like
39	58	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
63	120	Gene3D	G3DSA:1.20.5.1030	Preprotein translocase secy subunit
63	120	InterPro	IPR038379	SecE superfamily
14	33	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
118	122	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
87	107	PRINTS	PR01650	Bacterial translocase SecE signature
87	107	InterPro	IPR005807	SecE subunit of protein translocation complex, bacterial-like
42	63	PRINTS	PR01650	Bacterial translocase SecE signature
42	63	InterPro	IPR005807	SecE subunit of protein translocation complex, bacterial-like
63	83	PRINTS	PR01650	Bacterial translocase SecE signature
63	83	InterPro	IPR005807	SecE subunit of protein translocation complex, bacterial-like
107	122	PRINTS	PR01650	Bacterial translocase SecE signature
107	122	InterPro	IPR005807	SecE subunit of protein translocation complex, bacterial-like
34	38	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
93	117	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	13	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
95	117	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
70	121	Pfam	PF00584	SecE/Sec61-gamma subunits of protein translocation complex
70	121	InterPro	IPR001901	Protein translocase complex, SecE/Sec61-gamma subunit
69	97	ProSitePatterns	PS01067	Protein secE/sec61-gamma signature.
69	97	InterPro	IPR001901	Protein translocase complex, SecE/Sec61-gamma subunit
66	122	NCBIfam	TIGR00964	preprotein translocase subunit SecE
66	122	InterPro	IPR005807	SecE subunit of protein translocation complex, bacterial-like
12	34	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
61	120	Hamap	MF_00422	Protein translocase subunit SecE [secE].
61	120	InterPro	IPR001901	Protein translocase complex, SecE/Sec61-gamma subunit
39	58	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4276	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.766
3				0.296

PA4276