Overview
Basic information about this protein and its source genome.
- Accession
- PA4338
- Gene
- PA4338
- Status
- annotated
- Amino acids
- 426
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MATPDSKERFIGLEWLRFLLGLYVVVYHTLHTYPKEQKFPGLDELTSLGFFATSTFFVLSGFLLAHVYARSGRLRESARSFWTKRLSNLYPLHLFSLLLSILVLLALSHLGIGPELDKATPRFVIYDTNEVLGRTHPELFLHWMSNTELFVNSILQILLLQAWNPYYLTFNAPLWSLSTLMFFYLAFPFVAPRLMRSRHKWKVLALVWLVYLIPPALVVASESYGIPWTGLLHRNPLLRLPEFLGGILAYGLFRGYRDRGMVPGRGLLAALVALVVAAFLVADYLFTQGAKHWYFLLHNGLLLPAQLLLVCLCALPADPKSAFVRHWSPRLGAASLSLFALHVPMFTLFSRSERLIAVPGRCLDDWRACTEAAAALPSSLLYYPLFLVLLVAFCVLFQERGVVPVRKWLVRRLMPAPALAKVPRPA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
- GO:0009103 The chemical reactions and pathways resulting in the formation of lipopolysaccharides, any of a group of related, structurally complex components of the outer membrane of Gram-negative bacteria.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 172 | 191 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 204 | 226 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 268 | 287 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 236 | 253 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 47 | 69 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 293 | 315 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 288 | 292 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 169 | 191 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 50 | 69 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 398 | 426 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 90 | 112 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 192 | 202 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 327 | 349 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 90 | 112 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 12 | 30 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 375 | 397 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 266 | 288 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 293 | 315 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 350 | 379 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 203 | 226 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 227 | 237 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 12 | 397 | Pfam | PF01757 | Acyltransferase family |
| 12 | 397 | InterPro | IPR002656 | Acyltransferase 3 domain |
| 31 | 49 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 113 | 171 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 13 | 32 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 70 | 89 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 316 | 326 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 380 | 397 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 257 | 267 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 327 | 349 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 238 | 256 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 13 | 411 | PANTHER | PTHR23028 | ACETYLTRANSFERASE |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4338
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.748 | ||||||
| 15 | 0.242 |