Overview
Basic information about this protein and its source genome.
- Accession
- PA4353
- Gene
- PA4353
- Status
- annotated
- Amino acids
- 190
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNYLAHLHLGGPQPAQLLGSLYGDFVKGRLQGQWPDEIERAIQLHRRIDAFTDSHPLVHAAKRRFPLERRRFAGVLLDVFFDHCLARDWNDYADEPLPQFVERVYGTLRTASPLPERLARIAPRMAAQDWLGSYREFAVLREVLGGMSRRLSRPHLLDGSWEELAQRYDDLSADFRAFYPQLQAFALSQR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0008770 Catalysis of the reaction: [acyl-carrier protein] + H2O = 4'-phosphopantetheine + apoprotein.
- GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 190 | PIRSF | PIRSF011489 | UCP011489 |
| 1 | 190 | InterPro | IPR007431 | Acyl carrier protein phosphodiesterase |
| 81 | 184 | Pfam | PF04336 | Acyl carrier protein phosphodiesterase |
| 81 | 184 | InterPro | IPR007431 | Acyl carrier protein phosphodiesterase |
| 1 | 188 | PANTHER | PTHR38764 | ACYL CARRIER PROTEIN PHOSPHODIESTERASE |
| 1 | 188 | InterPro | IPR007431 | Acyl carrier protein phosphodiesterase |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4353
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.737 | ||||||
| 5 | 0.41 | ||||||
| 6 | 0.305 |