Protein profile

PA4359

ferrous iron transporter A

Genome: NC_002516.2

Gene: PA4359 Structure source: AlphaFold UniProt Q9HW42

Export view

Amino acids 75

Annotations 2

Features 9

PDB binders 0

Druggability 0.762

Overview

Basic information about this protein and its source genome.

Accession: PA4359
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4359
Status: annotated
Amino acids: 75
Structure source: AlphaFold

GO:0046914 Binding to a transition metal ions; a transition metal is an element whose atom has an incomplete d-subshell of extranuclear electrons, or which gives rise to a cation or cations with an incomplete d-subshell. Transition metals often have more than one valency state. Biologically relevant transition metals include vanadium, manganese, iron, copper, cobalt, nickel, molybdenum and silver. GO:0006974 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.762

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSALQPSRSYRITGYSPAISNGYRQRLFSMGLLPGAALRVVRIAPLGDPIQVETRQTSLALRRKDLALLTLVPLD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

GO:0046914 Binding to a transition metal ions; a transition metal is an element whose atom has an incomplete d-subshell of extranuclear electrons, or which gives rise to a cation or cations with an incomplete d-subshell. Transition metals often have more than one valency state. Biologically relevant transition metals include vanadium, manganese, iron, copper, cobalt, nickel, molybdenum and silver.
GO:0006974 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.

Sequence Features

Domain/signature hits from InterPro and related databases.

9 records

Show feature table

Start	End	DB	Term	Name
2	65	Pfam	PF04023	FeoA domain
2	65	InterPro	IPR007167	Ferrous iron transporter FeoA domain
8	75	Gene3D	G3DSA:2.30.30.90	-
8	75	InterPro	IPR038157	Ferrous iron transporter, core domain
2	70	PANTHER	PTHR42954	FE(2+) TRANSPORT PROTEIN A
3	71	SUPERFAMILY	SSF50037	C-terminal domain of transcriptional repressors
3	71	InterPro	IPR008988	Transcriptional repressor, C-terminal
1	73	SMART	SM00899	FeoA_2
1	73	InterPro	IPR007167	Ferrous iron transporter FeoA domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4359	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.762