Overview
Basic information about this protein and its source genome.
- Accession
- PA4359
- Gene
- PA4359
- Status
- annotated
- Amino acids
- 75
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSALQPSRSYRITGYSPAISNGYRQRLFSMGLLPGAALRVVRIAPLGDPIQVETRQTSLALRRKDLALLTLVPLD
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0046914 Binding to a transition metal ions; a transition metal is an element whose atom has an incomplete d-subshell of extranuclear electrons, or which gives rise to a cation or cations with an incomplete d-subshell. Transition metals often have more than one valency state. Biologically relevant transition metals include vanadium, manganese, iron, copper, cobalt, nickel, molybdenum and silver.
- GO:0006974 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 65 | Pfam | PF04023 | FeoA domain |
| 2 | 65 | InterPro | IPR007167 | Ferrous iron transporter FeoA domain |
| 8 | 75 | Gene3D | G3DSA:2.30.30.90 | - |
| 8 | 75 | InterPro | IPR038157 | Ferrous iron transporter, core domain |
| 2 | 70 | PANTHER | PTHR42954 | FE(2+) TRANSPORT PROTEIN A |
| 3 | 71 | SUPERFAMILY | SSF50037 | C-terminal domain of transcriptional repressors |
| 3 | 71 | InterPro | IPR008988 | Transcriptional repressor, C-terminal |
| 1 | 73 | SMART | SM00899 | FeoA_2 |
| 1 | 73 | InterPro | IPR007167 | Ferrous iron transporter FeoA domain |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4359
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.762 |