Protein profile

PA4401

glutathione S-transferase

Genome: NC_002516.2

Gene: PA4401 Structure source: AlphaFold UniProt Q9HW05
Export view
Amino acids 211
Annotations 4
Features 17
PDB binders 2
Druggability 0.681

Overview

Basic information about this protein and its source genome.

Accession
PA4401
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA4401
Status
annotated
Amino acids
211
Structure source
AlphaFold
GO
GO:0004364 Catalysis of the reaction: RX + glutathione = an S-substituted glutathione + a halide anion + H+. GO:0016034 Catalysis of the reaction: 4-maleylacetoacetate = 4-fumarylacetoacetate. GO:0006749 The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle. GO:0006559 The chemical reactions and pathways resulting in the breakdown of L-phenylalanine.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.681
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MALTIVIGNRNDSSWSLRGWLALRMSGAAFDEILVPLGRPDTRERILQYSPTGKVPLLKSEDGDIWDSLAIAEYLAERFPEAHLWPRGEAARALARSVCAEMHSGFAALRGELPMDLRRQQPLVELSEATRQDIQRICEAWADCLRRFGQDGPFLFGHASLADAFYAPVAARFRSYAVELPDIARTYVETIYQWPAFRAWYDAALREQAGS

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0004364 Catalysis of the reaction: RX + glutathione = an S-substituted glutathione + a halide anion + H+.
  • GO:0016034 Catalysis of the reaction: 4-maleylacetoacetate = 4-fumarylacetoacetate.
  • GO:0006749 The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
  • GO:0006559 The chemical reactions and pathways resulting in the breakdown of L-phenylalanine.

Sequence Features

Domain/signature hits from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
12 205 SFLD SFLDS00019 Glutathione Transferase (cytosolic)
12 205 InterPro IPR040079 Glutathione transferase family
11 81 Pfam PF13417 Glutathione S-transferase, N-terminal domain
11 81 InterPro IPR004045 Glutathione S-transferase, N-terminal
10 93 Gene3D G3DSA:3.40.30.10 Glutaredoxin
94 209 Gene3D G3DSA:1.20.1050.10 -
5 87 SUPERFAMILY SSF52833 Thioredoxin-like
5 87 InterPro IPR036249 Thioredoxin-like superfamily
89 203 CDD cd03194 GST_C_3
4 76 CDD cd03043 GST_N_1
12 200 PANTHER PTHR42673 MALEYLACETOACETATE ISOMERASE
129 203 Pfam PF13410 Glutathione S-transferase, C-terminal domain
3 83 ProSiteProfiles PS50404 Soluble glutathione S-transferase N-terminal domain profile.
3 83 InterPro IPR004045 Glutathione S-transferase, N-terminal
3 88 FunFam G3DSA:3.40.30.10:FF:000206 Probable glutathione S-transferase
84 201 SUPERFAMILY SSF47616 GST C-terminal domain-like
84 201 InterPro IPR036282 Glutathione S-transferase, C-terminal domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4401
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.681

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ETX
3BBY
P77544 90.1 Da LogP 0.02 TPSA 29.5 ✓ Ro5 ✓ Clean CCOCCO
GSH
4JBB
A6TBY7 307.3 Da LogP -2.21 TPSA 158.8 1 viol. ✓ Clean C(CC(=O)N[C@@H](CS)C(=O)NCC(=O)O)[C@@H](C(=O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.