Protein profile

PA4409

cell division protein FtsQ

Genome: NC_002516.2

Gene: PA4409 GUL26_13330 L4V69_30015 ALP65_02332 PAERUG_P19_London_7_VIM_2_05_10_00255 CAZ10_21275 GNQ48_11240 IPC1295_15580 ftsQ Structure source: AlphaFold UniProt G3XDA7 UniProt Q9LCT5
Export view
Amino acids 287
Annotations 6
Features 16
PDB binders 2
Druggability 0.759

Overview

Basic information about this protein and its source genome.

Accession
PA4409
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA4409 GUL26_13330 L4V69_30015 ALP65_02332 PAERUG_P19_London_7_VIM_2_05_10_00255 CAZ10_21275 GNQ48_11240 IPC1295_15580 ftsQ
Status
annotated
Amino acids
287
Structure source
AlphaFold
GO
GO:0032153 The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles. GO:1990587 A protein complex required for prokaryotic cell division (FtsZ-dependent cytokinesis). Part of the divisome. Assembled independently of the other divisome components in the cytoplasm prior to transport to the cell septum. In E. coli consists of FtsB, FtsL and FtsQ. GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0000917 The assembly and arrangement of a septum that spans the plasma membrane interface between progeny cells following cytokinesis. The progeny cells that form a division septum are not able to exchange intracellular material. GO:0043093 A cytokinesis process that involves a set of conserved proteins including FtsZ, and results in the formation of two similarly sized and shaped cells. GO:0090529 The assembly and arrangement of a cellular component that is composed of peptidoglycan and often chitin in addition to other materials and usually forms perpendicular to the long axis of a cell or hypha. It grows centripetally from the cell wall to the center of the cell and often functions in the compartmentalization of a cell into two daughter cells.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.759
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MNGVLLRHQQPGGLGRAPRKPMPRGASRLVAKEPLSVRLPKADFSFLKYLAWPLLLAVLGYGAYRGAEYILPYADRPIAKVSVEGDLSYISQRAVQQRISPYLAASFFTIDLAGMRGQLEQMPWIAHAEVRRVWPDQVVIRLDEQLPIARWGDEALLNNQGQAFTPKELANYEHLPRLHGPQRAQQQVMQQYQLLSQLLRPLGFSIARLEMSDRGGWALTTAQGVEIQIGRDHVVDKIRRFVSIYDKALKDQISNIARIDLRYPNGLAVAWREPVTPATVATASAVQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0032153 The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
  • GO:1990587 A protein complex required for prokaryotic cell division (FtsZ-dependent cytokinesis). Part of the divisome. Assembled independently of the other divisome components in the cytoplasm prior to transport to the cell septum. In E. coli consists of FtsB, FtsL and FtsQ.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0000917 The assembly and arrangement of a septum that spans the plasma membrane interface between progeny cells following cytokinesis. The progeny cells that form a division septum are not able to exchange intracellular material.
  • GO:0043093 A cytokinesis process that involves a set of conserved proteins including FtsZ, and results in the formation of two similarly sized and shaped cells.
  • GO:0090529 The assembly and arrangement of a cellular component that is composed of peptidoglycan and often chitin in addition to other materials and usually forms perpendicular to the long axis of a cell or hypha. It grows centripetally from the cell wall to the center of the cell and often functions in the compartmentalization of a cell into two daughter cells.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
46 64 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
46 270 Hamap MF_00911 Cell division protein FtsQ [ftsQ].
46 270 InterPro IPR026579 Cell division protein FtsQ
1 45 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
76 144 Gene3D G3DSA:3.10.20.310 membrane protein fhac
76 145 ProSiteProfiles PS51779 POTRA domain profile.
76 145 InterPro IPR034746 POTRA domain
146 275 Gene3D G3DSA:3.40.50.11690 Cell division protein FtsQ/DivIB
146 275 InterPro IPR045335 Cell division protein FtsQ, C-terminal
16 281 PANTHER PTHR35851 CELL DIVISION PROTEIN FTSQ
16 281 InterPro IPR026579 Cell division protein FtsQ
65 287 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
77 145 Pfam PF08478 POTRA domain, FtsQ-type
77 145 InterPro IPR013685 POTRA domain, FtsQ-type
149 262 Pfam PF03799 Cell division protein FtsQ/DivIB, C-terminal
149 262 InterPro IPR005548 Cell division protein FtsQ/DivIB, C-terminal

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4409
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.759
4 0.408

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
PEV
4V6M
Q8X9Y5 720.0 Da LogP 11.28 TPSA 134.4 2 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)O[C@@H](COC(=O)CCCCCCCCCC…
PGV
4V6M
Q8X9Y5 749.0 Da LogP 10.45 TPSA 148.8 2 viol. ✓ Clean CCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OC[C@H…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.