Overview
Basic information about this protein and its source genome.
- Accession
- PA4444
- Gene
- PA4444 mltB1
- Status
- annotated
- Amino acids
- 367
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRRTALALPLFLLVSACSSEPTPPPKPAAKPQARTVISPRPVRQSVQPILPLRGDYANNPAAQHFIDRMVSQHGFNRQQLHDLFAQTQRLDWVIRLMDRQAPTYTPPSGPNGAWLRYRKKFVTPGNVQNGVLFWDQYETDLQRASRVYGVPPEIIVGIIGVETRWGRVMGKTRIIDALSTLSFSYPRRAEFFSGELEQFLLQARKEGTDPLALRGSYAGAMGYGQFMPSSFTKYAVDFDGDGHIDLWNPRDAIGSVANYFKQHGWVSGDRVAVPASGRAPSLEDGFKTLYPLDVLASAGLRPQGPLGGHRQASLLRLDMGRNYQYWYGLPNFYVITRYNHSTHYAMAVWELGKEVDRVRHRSVVRQD
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0008933 Catalysis of the cleavage of a peptidoglycan chain into a peptidoglycan chain with N-acetyl-1,6-anhydromuramyl-[peptide] at the reducing end + a peptidoglycan chain with N-acetylglucosamine at the non-reducing end. Includes endolytic transglycosylase activity that fragments the glycan chain internally and exolytic transgylcosylase activity that cleaves a terminal disaccharide from the end of the glycan strand.
- GO:0009253 The chemical reactions and pathways resulting in the breakdown of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 19 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 4 | 14 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 59 | 352 | Pfam | PF13406 | Transglycosylase SLT domain |
| 59 | 352 | InterPro | IPR031304 | Transglycosylase SLT domain 2 |
| 1 | 19 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 148 | 353 | CDD | cd13399 | Slt35-like |
| 101 | 352 | Gene3D | G3DSA:1.10.530.10 | - |
| 2 | 357 | PANTHER | PTHR30163 | MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE B |
| 2 | 357 | InterPro | IPR043426 | Membrane-bound lytic murein transglycosylase B-like |
| 63 | 355 | NCBIfam | TIGR02282 | lytic murein transglycosylase B |
| 63 | 355 | InterPro | IPR011757 | Lytic transglycosylase MltB |
| 1 | 3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 17 | ProSiteProfiles | PS51257 | Prokaryotic membrane lipoprotein lipid attachment site profile. |
| 163 | 242 | FunFam | G3DSA:1.10.8.350:FF:000001 | Lytic murein transglycosylase B |
| 20 | 367 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 67 | 242 | Gene3D | G3DSA:1.10.8.350 | Bacterial muramidase |
| 1 | 28 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 50 | 354 | SUPERFAMILY | SSF53955 | Lysozyme-like |
| 50 | 354 | InterPro | IPR023346 | Lysozyme-like domain superfamily |
| 15 | 19 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4444
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.738 | ||||||
| 4 | 0.419 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| BLG | P41052 | 552.6 Da LogP -6.16 TPSA 271.9 | 3 viol. | ✓ Clean |
CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@H]1O[C@H]2…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC34074657 | 0.562 | 444.4 Da LogP -4.05 TPSA 221.2 | 2 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O[C@H]2C[C@@H](C(=O)O)N[C@@H…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.