Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA4444
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4444 mltB1
Status: annotated
Amino acids: 367
Structure source: AlphaFold

GO

GO:0008933 Catalysis of the cleavage of a peptidoglycan chain into a peptidoglycan chain with N-acetyl-1,6-anhydromuramyl-[peptide] at the reducing end + a peptidoglycan chain with N-acetylglucosamine at the non-reducing end. Includes endolytic transglycosylase activity that fragments the glycan chain internally and exolytic transgylcosylase activity that cleaves a terminal disaccharide from the end of the glycan strand. GO:0009253 The chemical reactions and pathways resulting in the breakdown of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.738

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MRRTALALPLFLLVSACSSEPTPPPKPAAKPQARTVISPRPVRQSVQPILPLRGDYANNPAAQHFIDRMVSQHGFNRQQLHDLFAQTQRLDWVIRLMDRQAPTYTPPSGPNGAWLRYRKKFVTPGNVQNGVLFWDQYETDLQRASRVYGVPPEIIVGIIGVETRWGRVMGKTRIIDALSTLSFSYPRRAEFFSGELEQFLLQARKEGTDPLALRGSYAGAMGYGQFMPSSFTKYAVDFDGDGHIDLWNPRDAIGSVANYFKQHGWVSGDRVAVPASGRAPSLEDGFKTLYPLDVLASAGLRPQGPLGGHRQASLLRLDMGRNYQYWYGLPNFYVITRYNHSTHYAMAVWELGKEVDRVRHRSVVRQD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2

GO:0008933 Catalysis of the cleavage of a peptidoglycan chain into a peptidoglycan chain with N-acetyl-1,6-anhydromuramyl-[peptide] at the reducing end + a peptidoglycan chain with N-acetylglucosamine at the non-reducing end. Includes endolytic transglycosylase activity that fragments the glycan chain internally and exolytic transgylcosylase activity that cleaves a terminal disaccharide from the end of the glycan strand.
GO:0009253 The chemical reactions and pathways resulting in the breakdown of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records

Show feature table

Start	End	DB	Term	Name
1	19	SignalP_EUK	SignalP-noTM	SignalP-noTM
4	14	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
59	352	Pfam	PF13406	Transglycosylase SLT domain
59	352	InterPro	IPR031304	Transglycosylase SLT domain 2
1	19	Phobius	SIGNAL_PEPTIDE	Signal peptide region
148	353	CDD	cd13399	Slt35-like
101	352	Gene3D	G3DSA:1.10.530.10	-
2	357	PANTHER	PTHR30163	MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE B
2	357	InterPro	IPR043426	Membrane-bound lytic murein transglycosylase B-like
63	355	NCBIfam	TIGR02282	lytic murein transglycosylase B
63	355	InterPro	IPR011757	Lytic transglycosylase MltB
1	3	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
1	17	ProSiteProfiles	PS51257	Prokaryotic membrane lipoprotein lipid attachment site profile.
163	242	FunFam	G3DSA:1.10.8.350:FF:000001	Lytic murein transglycosylase B
20	367	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
67	242	Gene3D	G3DSA:1.10.8.350	Bacterial muramidase
1	28	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
50	354	SUPERFAMILY	SSF53955	Lysozyme-like
50	354	InterPro	IPR023346	Lysozyme-like domain superfamily
15	19	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4444	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
2				0.738
4				0.419

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

2 records

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
BLG	1D0L	P41052	552.6 Da LogP -6.16 TPSA 271.9	3 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@H]1O[C@H]2…`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC34074657	0.562	444.4 Da LogP -4.05 TPSA 221.2	2 viol.	✓ Clean	`CC(=O)N[C@H]1[C@H](O[C@H]2C[C@@H](C(=O)O)N[C@@H…`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

PA4444