Protein profile

PA4456

ABC transporter ATP-binding protein

Genome: NC_002516.2

Gene: PA4456 Structure source: AlphaFold UniProt Q9HVW1
Export view
Amino acids 269
Annotations 3
Features 15
PDB binders 4
Druggability 0.732

Overview

Basic information about this protein and its source genome.

Accession
PA4456
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA4456
Status
annotated
Amino acids
269
Structure source
AlphaFold
GO
GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator. GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient. GO:0006869 The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
33.728
Human E-value
8.86e-17
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.732
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSTDSAYAVELKGLTFKRGSRAIFDNIDVRIPRGKVTGIMGPSGCGKTTLLRLIASQLRPSKGEVWVNGQNLPQLSRGDLFDMRKQFGVLFQSGALFTDLDVFENVAFPLRVHTQLPEEMIRDIVLMKLQAVGLRGAVELMPDELSGGMKRRVALARAIALDPQILLYDEPFVGQDPIAMGVLVRLIRLLNDALGITSIVVSHDLAETASIADYIYIVGDGRVLGHGTPDVLKETDDPRIRQFVKGIPDGPVPFHYPARDYRADLLGER

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
  • GO:0006869 The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
7 251 FunFam G3DSA:3.40.50.300:FF:000192 Phospholipid ABC transporter ATP-binding protein MlaF
9 245 ProSiteProfiles PS50893 ATP-binding cassette, ABC transporter-type domain profile.
9 245 InterPro IPR003439 ABC transporter-like, ATP-binding domain
8 234 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
8 234 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
9 243 CDD cd03261 ABC_Org_Solvent_Resistant
5 252 PANTHER PTHR43023 PROTEIN TRIGALACTOSYLDIACYLGLYCEROL 3, CHLOROPLASTIC
33 222 SMART SM00382 AAA_5
33 222 InterPro IPR003593 AAA+ ATPase domain
25 172 Pfam PF00005 ABC transporter
25 172 InterPro IPR003439 ABC transporter-like, ATP-binding domain
7 255 Gene3D G3DSA:3.40.50.300 -
7 255 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
145 159 ProSitePatterns PS00211 ABC transporters family signature.
145 159 InterPro IPR017871 ABC transporter-like, conserved site

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4456
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.567
1 0.396

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.

Show only:
Ligand Source crystal MW · LogP · TPSA Lipinski PAINS SMILES
ANP
7CHA
506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
LPP
7CHA
648.9 Da LogP 10.51 TPSA 119.4 2 viol. ✓ Clean CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)C…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.