Overview
Basic information about this protein and its source genome.
- Accession
- PA4473
- Gene
- PA4473 darP
- Status
- annotated
- Amino acids
- 200
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MAAHAAGPDKRPLTRYHGGVFHWTTTMAEFHDDDSQFEEKSKSQIKRELHALQDLGERLTTLQPQLLERLPLTDPLRKALLEAPKHKAHIARKRHIQYIGKLMRDQDVDAIVALIDQVDSSTRQYNERFHALERWRDQLIAGGDAALDAFVGEFPECDRQHLRGLVRHAQHEAAHNKPPAAARKVFKYIRELDETKRGLR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
4- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0043022 Binding to a ribosome.
- GO:0019843 Binding to a ribosomal RNA.
- GO:1902626 The aggregation, arrangement and bonding together of a set of components to form the large subunit precursor of the preribosome.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 39 | 190 | Pfam | PF04751 | Protein of unknown function (DUF615) |
| 39 | 190 | InterPro | IPR006839 | Ribosome-associated, YjgA |
| 29 | 194 | Hamap | MF_00765 | UPF0307 protein YjgA [yjgA]. |
| 29 | 194 | InterPro | IPR006839 | Ribosome-associated, YjgA |
| 49 | 124 | Gene3D | G3DSA:1.10.60.30 | - |
| 49 | 124 | InterPro | IPR023153 | PSPTO4464-like domain superfamily |
| 24 | 198 | PIRSF | PIRSF016183 | UCP016183 |
| 24 | 198 | InterPro | IPR006839 | Ribosome-associated, YjgA |
| 126 | 197 | FunFam | G3DSA:1.10.60.30:FF:000002 | UPF0307 protein YjgA |
| 28 | 197 | PANTHER | PTHR38101 | UPF0307 PROTEIN YJGA |
| 28 | 197 | InterPro | IPR006839 | Ribosome-associated, YjgA |
| 50 | 192 | SUPERFAMILY | SSF158710 | PSPTO4464-like |
| 50 | 192 | InterPro | IPR023153 | PSPTO4464-like domain superfamily |
| 39 | 191 | CDD | cd16331 | YjgA-like |
| 39 | 191 | InterPro | IPR006839 | Ribosome-associated, YjgA |
| 125 | 200 | Gene3D | G3DSA:1.10.60.30 | - |
| 125 | 200 | InterPro | IPR023153 | PSPTO4464-like domain superfamily |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4473
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.673 | ||||||
| 1 | 0.637 |