Protein profile

PA4487

hypothetical protein

Genome: NC_002516.2

Gene: PA4487 Structure source: AlphaFold UniProt Q9HVT4
Export view
Amino acids 263
Annotations 0
Features 12
PDB binders 0
Druggability 0.767

Overview

Basic information about this protein and its source genome.

Accession
PA4487
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA4487
Status
annotated
Amino acids
263
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.767
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MNRMSLAALLSCLPLVAWADNPVKLDTPVSGWRAGDGSAANYRQVVNYPASSVNVAADQATTARIRGAIESQPKDRPATLVVNGVSMPLKVDADGSFDRPFAFPSGSNSVEVRNAAGQSRRVQFYHGGGGGEVPAKLRVLLSWDSDNTDLDLHLVTPDGDHVWYGNRSLANGATLDVDVTTGYGPEIIATPTPQKGPYLVYVNYFGGGYGSSEDGAEQAAQDLTTARITLVTEEGTPNEKQETFLVPMRKPGELTLVKRFSYP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

12 records
Show feature table
Start End DB Term Name
1 262 PIRSF PIRSF012281 UCP012281
1 262 InterPro IPR012039 Uncharacterised conserved protein UCP012281
20 263 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
193 248 Pfam PF09906 Uncharacterized protein conserved in bacteria (DUF2135)
193 248 InterPro IPR019220 Domain of unknown function DUF2135
1 19 SignalP_EUK SignalP-noTM SignalP-noTM
16 19 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 19 Phobius SIGNAL_PEPTIDE Signal peptide region
1 19 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
5 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
115 216 Gene3D G3DSA:2.60.120.380 -

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4487
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
6 0.564
1 0.405
3 0.351