Overview
Basic information about this protein and its source genome.
- Accession
- PA4508
- Gene
- PA4508
- Status
- annotated
- Amino acids
- 157
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKLDAYDHRILAALQRDGRLSNVQLAEEIGLSPSPCLRRVRLLEEAGVIRGYQASIDRDEVGLGLTVFVGIKVERHRQEQAEAFHRAVVDLPEVISVHLVSGESDFLLQVVVPDLRAYERLLSETLLRLPGVSDIRSNFAIKTVKAPAPLPLGHLAG
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
4- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0043200 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 19 | 30 | PRINTS | PR00033 | AsnC bacterial regulatory protein HTH signature |
| 19 | 30 | InterPro | IPR000485 | AsnC-type HTH domain |
| 3 | 19 | PRINTS | PR00033 | AsnC bacterial regulatory protein HTH signature |
| 3 | 19 | InterPro | IPR000485 | AsnC-type HTH domain |
| 30 | 49 | PRINTS | PR00033 | AsnC bacterial regulatory protein HTH signature |
| 30 | 49 | InterPro | IPR000485 | AsnC-type HTH domain |
| 21 | 47 | ProSitePatterns | PS00519 | AsnC-type HTH domain signature. |
| 21 | 47 | InterPro | IPR019885 | Transcription regulator HTH, AsnC-type, conserved site |
| 63 | 152 | SUPERFAMILY | SSF54909 | Dimeric alpha+beta barrel |
| 63 | 152 | InterPro | IPR011008 | Dimeric alpha-beta barrel |
| 69 | 143 | Pfam | PF01037 | Lrp/AsnC ligand binding domain |
| 69 | 143 | InterPro | IPR019887 | Transcription regulator AsnC/Lrp, ligand binding domain |
| 3 | 64 | ProSiteProfiles | PS50956 | AsnC-type HTH domain profile. |
| 3 | 64 | InterPro | IPR000485 | AsnC-type HTH domain |
| 3 | 112 | SMART | SM00344 | asnc |
| 3 | 112 | InterPro | IPR019888 | Transcription regulator AsnC-like |
| 9 | 54 | CDD | cd00090 | HTH_ARSR |
| 9 | 54 | InterPro | IPR011991 | ArsR-like helix-turn-helix domain |
| 4 | 54 | Gene3D | G3DSA:1.10.10.10 | - |
| 4 | 54 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 56 | 140 | Gene3D | G3DSA:3.30.70.920 | - |
| 1 | 148 | PANTHER | PTHR30154 | LEUCINE-RESPONSIVE REGULATORY PROTEIN |
| 4 | 54 | FunFam | G3DSA:1.10.10.10:FF:000440 | AsnC family transcriptional regulator |
| 2 | 89 | SUPERFAMILY | SSF46785 | Winged helix DNA-binding domain |
| 2 | 89 | InterPro | IPR036390 | Winged helix DNA-binding domain superfamily |
| 3 | 50 | Pfam | PF13412 | Winged helix-turn-helix DNA-binding |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4508
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.624 | ||||||
| 2 | 0.456 | ||||||
| 3 | 0.375 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
No PDB ligands found through similar proteins.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC2390999 | 0.655 | 275.3 Da LogP -1.99 TPSA 172.8 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1605257 | 0.613 | 280.4 Da LogP 0.39 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)O
|
| ZINC1605258 | 0.613 | 280.4 Da LogP 0.39 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](NC(=O)[C@H](N)CCSC)C(=O)O
|
| ZINC1605259 | 0.613 | 280.4 Da LogP 0.39 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@H](CCSC)C(=O)O
|
| ZINC1605260 | 0.613 | 280.4 Da LogP 0.39 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)N[C@H](CCSC)C(=O)O
|
| ZINC3055005 | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC3055007 | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC3055010 | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC2391099 | 0.586 | 274.3 Da LogP -2.59 TPSA 178.6 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)O
|
| ZINC2522597 | 0.586 | 246.3 Da LogP -0.60 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)C[C@H](N)C(=O)O)C(=O)O
|
| ZINC1569523 | 0.581 | 206.3 Da LogP -0.73 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)NCC(=O)O
|
| ZINC1593212 | 0.581 | 206.3 Da LogP -0.73 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)NCC(=O)O
|
| ZINC2384813 | 0.576 | 236.3 Da LogP -1.37 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)O
|
| ZINC2384835 | 0.576 | 264.3 Da LogP -0.89 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)O
|
| ZINC2390943 | 0.576 | 248.3 Da LogP 0.29 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC4557150 | 0.576 | 236.3 Da LogP -1.37 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@H](CO)C(=O)O
|
| ZINC4899465 | 0.576 | 411.6 Da LogP 0.63 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCSC…
|
| ZINC64219373 | 0.576 | 411.6 Da LogP 0.63 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](CCSC)…
|
| ZINC1532219 | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
|
| ZINC1532220 | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)[C@H](N)CC(C)C)C(=O)O
|
| ZINC1532221 | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC1532222 | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC7997269 | 0.571 | 205.3 Da LogP 0.07 TPSA 99.2 | ✓ Ro5 | ✓ Clean |
CSC(=N)NCCC[C@@H](N)C(=O)O
|
| ZINC11755051 | 0.567 | 204.3 Da LogP 0.94 TPSA 46.3 | ✓ Ro5 | ✓ Clean |
CCN(CC)C(=O)[C@@H](N)CCSC
|
| ZINC57358674 | 0.567 | 205.3 Da LogP 1.41 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)OC(C)(C)C
|
| ZINC57933694 | 0.567 | 205.3 Da LogP 1.41 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)OC(C)(C)C
|
| ZINC62725402 | 0.567 | 204.3 Da LogP 0.94 TPSA 46.3 | ✓ Ro5 | ✓ Clean |
CCN(CC)C(=O)[C@H](N)CCSC
|
| ZINC1555366 | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1555367 | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1555369 | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720127 | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1720128 | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720130 | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC19796052 | 0.553 | 219.2 Da LogP -1.73 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
N/C(=N\[N+](=O)[O-])NCCC[C@H](N)C(=O)O
|
| ZINC21982226 | 0.553 | 219.2 Da LogP -1.73 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
N/C(=N\[N+](=O)[O-])NCCC[C@@H](N)C(=O)O
|
| ZINC1581634 | 0.552 | 203.2 Da LogP -2.22 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)NCC(=O)O
|
| ZINC1605717 | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC1605718 | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC1605719 | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
|
| ZINC1605720 | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
|
| ZINC5500823 | 0.552 | 203.2 Da LogP -2.22 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@@H](N)C(=O)NCC(=O)O
|
| ZINC2390945 | 0.543 | 262.4 Da LogP 0.68 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
|
| ZINC2516118 | 0.543 | 278.3 Da LogP -0.50 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC4557160 | 0.543 | 262.4 Da LogP 0.68 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
|
| ZINC4557161 | 0.543 | 262.4 Da LogP 0.68 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC4557162 | 0.543 | 262.4 Da LogP 0.68 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC1541834 | 0.533 | 218.3 Da LogP -1.08 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)O
|
| ZINC2556618 | 0.533 | 246.3 Da LogP -0.60 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)O
|
| ZINC4556665 | 0.533 | 357.5 Da LogP 1.51 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](…
|
| ZINC4556684 | 0.533 | 218.3 Da LogP -1.08 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](CO)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.