Protein profile

PA4508

transcriptional regulator

Genome: NC_002516.2

Gene: PA4508 Structure source: AlphaFold UniProt Q9HVR3
Amino acids 157
Annotations 4
Features 26
PDB binders 0
Druggability 0.684

Overview

Basic information about this protein and its source genome.

Accession
PA4508
Gene
PA4508
Status
annotated
Amino acids
157
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.684
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKLDAYDHRILAALQRDGRLSNVQLAEEIGLSPSPCLRRVRLLEEAGVIRGYQASIDRDEVGLGLTVFVGIKVERHRQEQAEAFHRAVVDLPEVISVHLVSGESDFLLQVVVPDLRAYERLLSETLLRLPGVSDIRSNFAIKTVKAPAPLPLGHLAG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0043200 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.

Sequence Features

Domain/signature hits from InterPro and related databases.

26 records
Show feature table
Start End DB Term Name
19 30 PRINTS PR00033 AsnC bacterial regulatory protein HTH signature
19 30 InterPro IPR000485 AsnC-type HTH domain
3 19 PRINTS PR00033 AsnC bacterial regulatory protein HTH signature
3 19 InterPro IPR000485 AsnC-type HTH domain
30 49 PRINTS PR00033 AsnC bacterial regulatory protein HTH signature
30 49 InterPro IPR000485 AsnC-type HTH domain
21 47 ProSitePatterns PS00519 AsnC-type HTH domain signature.
21 47 InterPro IPR019885 Transcription regulator HTH, AsnC-type, conserved site
63 152 SUPERFAMILY SSF54909 Dimeric alpha+beta barrel
63 152 InterPro IPR011008 Dimeric alpha-beta barrel
69 143 Pfam PF01037 Lrp/AsnC ligand binding domain
69 143 InterPro IPR019887 Transcription regulator AsnC/Lrp, ligand binding domain
3 64 ProSiteProfiles PS50956 AsnC-type HTH domain profile.
3 64 InterPro IPR000485 AsnC-type HTH domain
3 112 SMART SM00344 asnc
3 112 InterPro IPR019888 Transcription regulator AsnC-like
9 54 CDD cd00090 HTH_ARSR
9 54 InterPro IPR011991 ArsR-like helix-turn-helix domain
4 54 Gene3D G3DSA:1.10.10.10 -
4 54 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
56 140 Gene3D G3DSA:3.30.70.920 -
1 148 PANTHER PTHR30154 LEUCINE-RESPONSIVE REGULATORY PROTEIN
4 54 FunFam G3DSA:1.10.10.10:FF:000440 AsnC family transcriptional regulator
2 89 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
2 89 InterPro IPR036390 Winged helix DNA-binding domain superfamily
3 50 Pfam PF13412 Winged helix-turn-helix DNA-binding

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4508
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.624
2 0.456
3 0.375

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

50 records

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Show only:
Ligand Tanimoto MW · LogP · TPSA Lipinski PAINS SMILES
ZINC2390999 0.655 275.3 Da LogP -1.99 TPSA 172.8 ✓ Ro5 ✓ Clean NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
ZINC1605257 0.613 280.4 Da LogP 0.39 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)O
ZINC1605258 0.613 280.4 Da LogP 0.39 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@H](NC(=O)[C@H](N)CCSC)C(=O)O
ZINC1605259 0.613 280.4 Da LogP 0.39 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@H](CCSC)C(=O)O
ZINC1605260 0.613 280.4 Da LogP 0.39 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@@H](N)C(=O)N[C@H](CCSC)C(=O)O
ZINC3055005 0.591 204.2 Da LogP -0.63 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCC[C@H](N)C(=O)O)C(=O)O
ZINC3055007 0.591 204.2 Da LogP -0.63 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCC[C@@H](N)C(=O)O)C(=O)O
ZINC3055010 0.591 204.2 Da LogP -0.63 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](CCCC[C@@H](N)C(=O)O)C(=O)O
ZINC2391099 0.586 274.3 Da LogP -2.59 TPSA 178.6 ✓ Ro5 ✓ Clean NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)O
ZINC2522597 0.586 246.3 Da LogP -0.60 TPSA 129.7 ✓ Ro5 ✓ Clean CC(C)C[C@H](NC(=O)C[C@H](N)C(=O)O)C(=O)O
ZINC1569523 0.581 206.3 Da LogP -0.73 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@@H](N)C(=O)NCC(=O)O
ZINC1593212 0.581 206.3 Da LogP -0.73 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)NCC(=O)O
ZINC2384813 0.576 236.3 Da LogP -1.37 TPSA 112.7 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)O
ZINC2384835 0.576 264.3 Da LogP -0.89 TPSA 129.7 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)O
ZINC2390943 0.576 248.3 Da LogP 0.29 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@H](C(=O)O)C(C)C
ZINC4557150 0.576 236.3 Da LogP -1.37 TPSA 112.7 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@H](CO)C(=O)O
ZINC4899465 0.576 411.6 Da LogP 0.63 TPSA 121.5 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCSC…
ZINC64219373 0.576 411.6 Da LogP 0.63 TPSA 121.5 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](CCSC)…
ZINC1532219 0.571 244.3 Da LogP 0.98 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
ZINC1532220 0.571 244.3 Da LogP 0.98 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)C[C@H](NC(=O)[C@H](N)CC(C)C)C(=O)O
ZINC1532221 0.571 244.3 Da LogP 0.98 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)C[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
ZINC1532222 0.571 244.3 Da LogP 0.98 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)C[C@@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
ZINC7997269 0.571 205.3 Da LogP 0.07 TPSA 99.2 ✓ Ro5 ✓ Clean CSC(=N)NCCC[C@@H](N)C(=O)O
ZINC11755051 0.567 204.3 Da LogP 0.94 TPSA 46.3 ✓ Ro5 ✓ Clean CCN(CC)C(=O)[C@@H](N)CCSC
ZINC57358674 0.567 205.3 Da LogP 1.41 TPSA 52.3 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)OC(C)(C)C
ZINC57933694 0.567 205.3 Da LogP 1.41 TPSA 52.3 ✓ Ro5 ✓ Clean CSCC[C@@H](N)C(=O)OC(C)(C)C
ZINC62725402 0.567 204.3 Da LogP 0.94 TPSA 46.3 ✓ Ro5 ✓ Clean CCN(CC)C(=O)[C@H](N)CCSC
ZINC1555366 0.565 232.3 Da LogP 0.15 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCCCC[C@H](N)C(=O)O)C(=O)O
ZINC1555367 0.565 232.3 Da LogP 0.15 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
ZINC1555369 0.565 232.3 Da LogP 0.15 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
ZINC1720127 0.565 218.3 Da LogP -0.24 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCCC[C@H](N)C(=O)O)C(=O)O
ZINC1720128 0.565 218.3 Da LogP -0.24 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
ZINC1720130 0.565 218.3 Da LogP -0.24 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
ZINC19796052 0.553 219.2 Da LogP -1.73 TPSA 156.9 ✓ Ro5 ✓ Clean N/C(=N\[N+](=O)[O-])NCCC[C@H](N)C(=O)O
ZINC21982226 0.553 219.2 Da LogP -1.73 TPSA 156.9 ✓ Ro5 ✓ Clean N/C(=N\[N+](=O)[O-])NCCC[C@@H](N)C(=O)O
ZINC1581634 0.552 203.2 Da LogP -2.22 TPSA 135.5 ✓ Ro5 ✓ Clean NC(=O)CC[C@H](N)C(=O)NCC(=O)O
ZINC1605717 0.552 230.3 Da LogP 0.59 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)C[C@H](N)C(=O)N[C@H](C(=O)O)C(C)C
ZINC1605718 0.552 230.3 Da LogP 0.59 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)C[C@@H](N)C(=O)N[C@H](C(=O)O)C(C)C
ZINC1605719 0.552 230.3 Da LogP 0.59 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)C[C@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
ZINC1605720 0.552 230.3 Da LogP 0.59 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)C[C@@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
ZINC5500823 0.552 203.2 Da LogP -2.22 TPSA 135.5 ✓ Ro5 ✓ Clean NC(=O)CC[C@@H](N)C(=O)NCC(=O)O
ZINC2390945 0.543 262.4 Da LogP 0.68 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
ZINC2516118 0.543 278.3 Da LogP -0.50 TPSA 129.7 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O
ZINC4557160 0.543 262.4 Da LogP 0.68 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
ZINC4557161 0.543 262.4 Da LogP 0.68 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
ZINC4557162 0.543 262.4 Da LogP 0.68 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
ZINC1541834 0.533 218.3 Da LogP -1.08 TPSA 112.7 ✓ Ro5 ✓ Clean CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)O
ZINC2556618 0.533 246.3 Da LogP -0.60 TPSA 129.7 ✓ Ro5 ✓ Clean CC(C)C[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)O
ZINC4556665 0.533 357.5 Da LogP 1.51 TPSA 121.5 ✓ Ro5 ✓ Clean CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](…
ZINC4556684 0.533 218.3 Da LogP -1.08 TPSA 112.7 ✓ Ro5 ✓ Clean CC(C)C[C@@H](N)C(=O)N[C@@H](CO)C(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.