Overview
Basic information about this protein and its source genome.
- Accession
- PA4534
- Gene
- PA4534
- Status
- annotated
- Amino acids
- 141
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MQLRSVIAADHPALFALWSRTPGIRLRAEDAYPFFLAYLQRNPGLSLLVETEGEVIACLMAGHDGRRGYLQHLVVDPGYRGLGLARRMLDEVLARLAREGIGKSHVFVLDAAEEAQAFWRAQSDWERRKDIQVFSTREGHA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 46 | 106 | CDD | cd04301 | NAT_SF |
| 1 | 121 | PANTHER | PTHR43877 | - |
| 23 | 120 | Pfam | PF00583 | Acetyltransferase (GNAT) family |
| 23 | 120 | InterPro | IPR000182 | GNAT domain |
| 1 | 127 | SUPERFAMILY | SSF55729 | Acyl-CoA N-acyltransferases (Nat) |
| 1 | 127 | InterPro | IPR016181 | Acyl-CoA N-acyltransferase |
| 1 | 141 | ProSiteProfiles | PS51186 | Gcn5-related N-acetyltransferase (GNAT) domain profile. |
| 1 | 141 | InterPro | IPR000182 | GNAT domain |
| 1 | 137 | FunFam | G3DSA:3.40.630.30:FF:000183 | Acetyltransferase YpeA |
| 1 | 137 | Gene3D | G3DSA:3.40.630.30 | - |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
1 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.766 | ||||||
| 1 | 0.283 | ||||||
| 6 | 0.206 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 7.03 | 0.364 | ||||||
| 2 | 7.02 | 0.363 | ||||||
| 3 | 3.01 | 0.099 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.719 | ||||||
| 1 | 0.378 |