Protein profile

PA4567

50S ribosomal protein L27

Genome: NC_002516.2

Gene: rpmA PA4567 Structure source: AlphaFold UniProt Q9HVL7
Export view
Amino acids 85
Annotations 6
Features 19
PDB binders 1
Druggability 0.736

Overview

Basic information about this protein and its source genome.

Accession
PA4567
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
rpmA PA4567
Status
annotated
Amino acids
85
Structure source
AlphaFold
GO
GO:0022625 The large subunit of a ribosome located in the cytosol. GO:0043022 Binding to a ribosome. GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome. GO:1902626 The aggregation, arrangement and bonding together of a set of components to form the large subunit precursor of the preribosome. GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome. GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
43.478
Human E-value
5.74e-11
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.736
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MAHKKAGGSTRNGRDSESKRLGVKLFGGQAVKAGNILVRQRGTKFHAGYGVGLGKDHTLFAKVDGVVKFETKGAFGRKYVSIVAA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0022625 The large subunit of a ribosome located in the cytosol.
  • GO:0043022 Binding to a ribosome.
  • GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome.
  • GO:1902626 The aggregation, arrangement and bonding together of a set of components to form the large subunit precursor of the preribosome.
  • GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
  • GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
1 83 PANTHER PTHR15893 RIBOSOMAL PROTEIN L27
1 83 InterPro IPR001684 Ribosomal protein L27
2 80 SUPERFAMILY SSF110324 Ribosomal L27 protein-like
6 84 Gene3D G3DSA:2.40.50.100 -
1 83 NCBIfam TIGR00062 50S ribosomal protein L27
4 28 PRINTS PR00063 Ribosomal protein L27 signature
4 28 InterPro IPR001684 Ribosomal protein L27
29 53 PRINTS PR00063 Ribosomal protein L27 signature
29 53 InterPro IPR001684 Ribosomal protein L27
54 78 PRINTS PR00063 Ribosomal protein L27 signature
54 78 InterPro IPR001684 Ribosomal protein L27
6 85 FunFam G3DSA:2.40.50.100:FF:000001 50S ribosomal protein L27
1 85 Hamap MF_00539 50S ribosomal protein L27 [rpmA].
1 85 InterPro IPR001684 Ribosomal protein L27
1 21 MobiDBLite mobidb-lite consensus disorder prediction
2 82 Pfam PF01016 Ribosomal L27 protein
2 82 InterPro IPR001684 Ribosomal protein L27
34 48 ProSitePatterns PS00831 Ribosomal protein L27 signature.
34 48 InterPro IPR018261 Ribosomal protein L27, conserved site

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4567
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.736

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

11 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
BLS
6B4V
Q72HR3 422.4 Da LogP -2.22 TPSA 215.7 1 viol. ✓ Clean [H]/N=C(\N)/N(C)CC[C@@H](CC(=O)N[C@H]1C=C[C@@H]…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.