Protein profile

PA4612

hypothetical protein

Genome: NC_002516.2

Gene: PA4612 Structure source: AlphaFold UniProt G3XD34
Amino acids 183
Annotations 1
Features 27
PDB binders 16
Druggability 0.756

Overview

Basic information about this protein and its source genome.

Accession
PA4612
Gene
PA4612
Status
annotated
Amino acids
183
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
41.667
Human E-value
6e-06
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.756
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTTMRGWILAGLLLAALAAQAGEVHGVEVEARLRDYFFDAARRGDQAMLKEFVEAGFDLDVQDAKGYTALILAAYHGHGGAVEQLLEAGADPCVQDARGNTALMGAIFKGEVRIARRLIGAQCSPDQRNGAGQTAAMYAALFKREELLQALSARGADLGARDALGNSVESLRRGELNGTAAAR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

1

Sequence Features

Domain/signature hits from InterPro and related databases.

27 records
Show feature table
Start End DB Term Name
1 26 SignalP_EUK SignalP-noTM SignalP-noTM
18 174 Gene3D G3DSA:1.25.40.20 -
18 174 InterPro IPR036770 Ankyrin repeat-containing domain superfamily
65 96 ProSiteProfiles PS50297 Ankyrin repeat region circular profile.
27 183 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
98 127 SMART SM00248 ANK_2a
98 127 InterPro IPR002110 Ankyrin repeat
131 160 SMART SM00248 ANK_2a
131 160 InterPro IPR002110 Ankyrin repeat
32 61 SMART SM00248 ANK_2a
32 61 InterPro IPR002110 Ankyrin repeat
65 94 SMART SM00248 ANK_2a
65 94 InterPro IPR002110 Ankyrin repeat
1 26 Phobius SIGNAL_PEPTIDE Signal peptide region
1 21 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
65 97 ProSiteProfiles PS50088 Ankyrin repeat profile.
65 97 InterPro IPR002110 Ankyrin repeat
1 6 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
19 26 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
36 168 SUPERFAMILY SSF48403 Ankyrin repeat
36 168 InterPro IPR036770 Ankyrin repeat-containing domain superfamily
7 18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
38 166 PANTHER PTHR24173 ANKYRIN REPEAT CONTAINING
131 163 ProSiteProfiles PS50088 Ankyrin repeat profile.
131 163 InterPro IPR002110 Ankyrin repeat
39 127 Pfam PF12796 Ankyrin repeats (3 copies)
39 127 InterPro IPR002110 Ankyrin repeat

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4612
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.756
3 0.274

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

166 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
144 Q978J0 122.1 Da LogP -1.72 TPSA 60.7 ✓ Ro5 ✓ Clean C[N+](CO)(CO)CO
25A A5H025 1005.6 Da LogP -3.50 TPSA 495.7 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
25L A5H025 1165.6 Da LogP -3.26 TPSA 588.8 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
27K A5H025 194.2 Da LogP 2.35 TPSA 46.5 ✓ Ro5 ✓ Clean CCCCOC(=O)c1ccc(cc1)O
90P Q9H9B1 427.6 Da LogP 4.31 TPSA 62.8 ✓ Ro5 ✓ Clean CCN1CCC(CC1)Nc2c3cc(c(cc3nc(n2)N(C)C4CCCCC4)OC)…
ACP Q05823 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ANP A5H025 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
B49 A5H025 398.5 Da LogP 3.33 TPSA 77.2 ✓ Ro5 ✓ Clean CCN(CC)CCNC(=O)c1c(c([nH]c1C)/C=C\2/c3cc(ccc3NC…
BU2 Q978J0 90.1 Da LogP -0.25 TPSA 40.5 ✓ Ro5 ✓ Clean C[C@@H](CCO)O
BWC A5H025 396.5 Da LogP 3.09 TPSA 77.2 ✓ Ro5 ✓ Clean Cc1c([nH]c(c1C(=O)NCCN2CCCC2)C)/C=C\3/c4cc(ccc4…
E11 Q9H9B1 478.6 Da LogP 4.09 TPSA 74.8 ✓ Ro5 ✓ Clean CN(C)CCCNc1nc2cc(c(cc2c(n1)NC3CCN(CC3)Cc4ccccc4…
E67 Q9H9B1 549.8 Da LogP 4.59 TPSA 100.8 1 viol. ✓ Clean CN(C)CCCNc1nc2cc(c(cc2c(n1)NC3CCN(CC3)Cc4ccccc4…
J60 A5H025 414.9 Da LogP 3.85 TPSA 77.2 ✓ Ro5 ✓ Clean CCN(CC)CCNC(=O)c1c(c([nH]c1C)\C=C/2\c3cc(ccc3NC…
JDG Q9H9B1 523.8 Da LogP 5.44 TPSA 61.7 2 viol. ✓ Clean CC(C)N1CCC(CC1)NC2=NCC(=Nc3c2cc(c(c3)OCCCN4CCCC…
MYC A5H025 318.2 Da LogP 1.69 TPSA 151.6 1 viol. Alert c1c(cc(c(c1O)O)O)C2=C(C(=O)c3c(cc(cc3O2)O)O)O
PUP Q05823 520.3 Da LogP -3.47 TPSA 256.5 3 viol. ✓ Clean C1[C@@H]([C@@H]([C@H](O1)CO)OP(=O)(O)OC[C@@H]2[…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.