Overview
Basic information about this protein and its source genome.
- Accession
- PA4674
- Gene
- PA4674
- Status
- annotated
- Amino acids
- 101
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MATNGMRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLLAHG
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 25 | 70 | ProSiteProfiles | PS50943 | Cro/C1-type HTH domain profile. |
| 25 | 70 | InterPro | IPR001387 | Cro/C1-type helix-turn-helix domain |
| 22 | 69 | Pfam | PF01381 | Helix-turn-helix |
| 22 | 69 | InterPro | IPR001387 | Cro/C1-type helix-turn-helix domain |
| 1 | 99 | Gene3D | G3DSA:1.10.260.40 | - |
| 1 | 99 | InterPro | IPR010982 | Lambda repressor-like, DNA-binding domain superfamily |
| 14 | 70 | SMART | SM00530 | mbf_short4 |
| 14 | 70 | InterPro | IPR001387 | Cro/C1-type helix-turn-helix domain |
| 1 | 97 | PANTHER | PTHR36924 | ANTITOXIN HIGA-1 |
| 1 | 97 | InterPro | IPR013430 | Toxin-antitoxin system, antidote protein, HigA |
| 6 | 82 | NCBIfam | TIGR02607 | HigA family addiction module antitoxin |
| 6 | 82 | InterPro | IPR013430 | Toxin-antitoxin system, antidote protein, HigA |
| 10 | 91 | SUPERFAMILY | SSF47413 | lambda repressor-like DNA-binding domains |
| 10 | 91 | InterPro | IPR010982 | Lambda repressor-like, DNA-binding domain superfamily |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
5 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
PDB
7CSV
|
X-ray | 1.71 Å | A,B |
|
Viewing | |
|
PDB
7CSW
|
X-ray | 1.97 Å | A,B |
|
Loaded | |
|
PDB
7CSY
|
X-ray | 2.29 Å | A,B,C,D |
|
Loaded | |
|
PDB
6LB3
|
X-ray | 2.50 Å | A,B,C,D,E,F,G,H |
|
Loaded | |
|
PDB
6JPI
|
X-ray | 3.14 Å | A,B,C,D |
|
Loaded | |
|
AlphaFold
PA4674
|
AlphaFold | — | — | full sequence | — | Loaded |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.744 |