Protein profile

PA4728

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase

Genome: NC_002516.2

Gene: PA4728 folK Structure source: AlphaFold UniProt Q9HV71
Amino acids 162
Annotations 7
Features 13
PDB binders 28
Druggability 0.673

Overview

Basic information about this protein and its source genome.

Accession
PA4728
Gene
PA4728 folK
Status
annotated
Amino acids
162
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.673
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVAALDTNLAPLDLLDALQAIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQARAFVLYPLADLAPDLRLPDGRHLPELLAACPFEGIERLPGA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0003848 Catalysis of the reaction: 2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine + ATP = (2-amino-4-hydroxy-7,8-dihydropteridin-6-yl)methyl diphosphate + AMP + 2 H+.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0016301 Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
  • GO:0046656 The chemical reactions and pathways resulting in the formation of folic acid, pteroylglutamic acid.
  • GO:0046654 The chemical reactions and pathways resulting in the formation of tetrahydrofolate, 5,6,7,8-tetrahydrofolic acid, a folate derivative bearing additional hydrogens on the pterin group.
  • GO:0009396 The chemical reactions and pathways resulting in the formation of folic acid and its derivatives.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
3 157 SUPERFAMILY SSF55083 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK
3 157 InterPro IPR035907 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK superfamily
5 134 NCBIfam TIGR01498 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
5 134 InterPro IPR000550 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
6 134 Pfam PF01288 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
6 134 InterPro IPR000550 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
89 100 ProSitePatterns PS00794 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase signature.
89 100 InterPro IPR000550 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
2 159 Gene3D G3DSA:3.30.70.560 -
2 159 InterPro IPR035907 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK superfamily
1 158 PANTHER PTHR43071 2-AMINO-4-HYDROXY-6-HYDROXYMETHYLDIHYDROPTERIDINE PYROPHOSPHOKINASE
5 132 CDD cd00483 HPPK
5 132 InterPro IPR000550 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4728
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.673

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

99 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
5RW Q2G0Q5 291.3 Da LogP 1.66 TPSA 100.5 ✓ Ro5 ✓ Clean c1cc(ccc1CSc2[nH]c3c(n2)N=C(NC3=O)N)F
5RX Q2G0Q5 307.8 Da LogP 2.17 TPSA 100.5 ✓ Ro5 ✓ Clean c1cc(ccc1CSc2[nH]c3c(n2)C(=O)NC(=N3)N)Cl
5RY Q2G0Q5 316.3 Da LogP 1.53 TPSA 124.2 ✓ Ro5 ✓ Clean c1cc(c(cc1C#N)F)CSc2[nH]c3c(n2)C(=O)NC(=N3)N
5RZ Q2G0Q5 380.2 Da LogP 1.97 TPSA 117.5 ✓ Ro5 ✓ Clean c1cc(ccc1C(=O)CSc2[nH]c3c(n2)C(=O)NC(=N3)N)Br
87Y P26281 313.4 Da LogP 1.23 TPSA 116.4 ✓ Ro5 ✓ Clean C[C@@]1(C(=NC2=C(N1)N=C(NC2=O)N)CO)CCc3ccccc3
A4P P26281 764.3 Da LogP -1.62 TPSA 410.8 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
APC A0A5P8YCA3 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
DX4 P26281 167.2 Da LogP 0.60 TPSA 83.4 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)C(=S)NC(=N2)N
H73 P26281 672.7 Da LogP -1.56 TPSA 285.1 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCCN3CC[C@H](C…
HH2 P26281 353.1 Da LogP -0.98 TPSA 210.8 ✓ Ro5 ✓ Clean c1c(nc2c(n1)N=C(NC2=O)N)CO[P@](=O)(O)OP(=O)(O)O
HHR P26281 193.2 Da LogP -1.21 TPSA 117.8 ✓ Ro5 ✓ Clean c1c(nc2c(n1)N=C(NC2=O)N)CO
HHS P26281 207.1 Da LogP -1.01 TPSA 134.8 ✓ Ro5 ✓ Clean c1c(nc2c(n1)N=C(NC2=O)N)C(=O)O
J1A P26281 584.7 Da LogP -1.38 TPSA 232.1 3 viol. ✓ Clean c1c(nc2c(n1)N=C(NC2=O)N)CNCCN3CCC(CC3)SC[C@@H]4…
J1B P26281 614.7 Da LogP -0.54 TPSA 230.7 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)CNCCN3CCC(CC3)SC[C@…
J1C P26281 628.7 Da LogP -1.02 TPSA 247.8 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCCN3CCC(CC3)S…
J1D P26281 634.6 Da LogP -3.68 TPSA 307.8 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCC(=O)NCCS(=O…
J1F P26281 693.6 Da LogP -4.13 TPSA 351.5 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCC(=O)N(CC(=O…
J1I P26281 682.7 Da LogP -2.04 TPSA 305.3 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCCN(CCSC[C@@H…
J1L P26281 704.7 Da LogP -2.88 TPSA 319.2 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCCN3CC[C@H](C…
PH2 A0A5P8YCA3 195.2 Da LogP -1.16 TPSA 116.4 ✓ Ro5 ✓ Clean C1C(=NC2=C(N1)N=C(NC2=O)N)CO
ROI P43777 209.2 Da LogP 0.14 TPSA 116.4 ✓ Ro5 ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)O)C
YH1 P26281 301.3 Da LogP 1.20 TPSA 117.5 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)CSc2[nH]c3c(n2)C(=O)NC(=N3)N
YH2 Q2G0Q5 298.3 Da LogP 1.39 TPSA 124.2 ✓ Ro5 ✓ Clean c1cc(ccc1CSc2[nH]c3c(n2)C(=O)NC(=N3)N)C#N
YH3 P26281 315.4 Da LogP 1.51 TPSA 117.5 ✓ Ro5 ✓ Clean Cc1cccc(c1)C(=O)CSc2[nH]c3c(n2)C(=O)NC(=N3)N
YH4 P26281 315.4 Da LogP 1.51 TPSA 117.5 ✓ Ro5 ✓ Clean Cc1ccccc1C(=O)CSc2[nH]c3c(n2)N=C(NC3=O)N
YH5 P26281 331.4 Da LogP 1.21 TPSA 126.8 ✓ Ro5 ✓ Clean COc1ccc(cc1)C(=O)CSc2[nH]c3c(n2)C(=O)NC(=N3)N
YH6 P26281 315.4 Da LogP 1.51 TPSA 117.5 ✓ Ro5 ✓ Clean Cc1ccc(cc1)C(=O)CSc2[nH]c3c(n2)N=C(NC3=O)N
YH7 P26281 167.2 Da LogP 0.60 TPSA 83.4 ✓ Ro5 ✓ Clean C1=NC2=C(NC(=S)N=C2N1)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.