Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA4746
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4746 rimP
Status: annotated
Amino acids: 152
Structure source: AlphaFold

GO

GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. GO:0000028 The aggregation, arrangement and bonding together of constituent RNAs and proteins to form the small ribosomal subunit. GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome. GO:0042274 A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of a small ribosomal subunit; includes transport to the sites of protein synthesis.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.763

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSSKLEQLQALLAPVVEALGYECWGVEFISQGRHSVLRVYIDRPEGILIDDCEAVSRQVSGILDVEDPISGEYTLEVSSPGMDRPLFTLEQFAKHAGEQVKIRLRSPYEGRRNYQGILRGVEEQDVVVLVDDHEYLLPIDSIDKANIIPRFD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4

GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
GO:0000028 The aggregation, arrangement and bonding together of constituent RNAs and proteins to form the small ribosomal subunit.
GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
GO:0042274 A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of a small ribosomal subunit; includes transport to the sites of protein synthesis.

Sequence Features

Domain/signature hits from InterPro and related databases.

24 records

Show feature table

Start	End	DB	Term	Name
1	7	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
1	80	Gene3D	G3DSA:3.30.300.70	-
1	80	InterPro	IPR035956	RimP, N-terminal domain superfamily
8	16	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
1	151	PANTHER	PTHR33867	RIBOSOME MATURATION FACTOR RIMP
1	151	InterPro	IPR003728	Ribosome maturation factor RimP
11	83	Pfam	PF02576	RimP N-terminal domain
11	83	InterPro	IPR028989	Ribosome maturation factor RimP, N-terminal
81	151	CDD	cd01734	YlxS_C
81	151	InterPro	IPR028998	Ribosome maturation factor RimP, C-terminal
6	151	Hamap	MF_01077	Ribosome maturation factor RimP [rimP].
6	151	InterPro	IPR003728	Ribosome maturation factor RimP
88	148	Gene3D	G3DSA:2.30.30.180	-
1	80	FunFam	G3DSA:3.30.300.70:FF:000001	Ribosome maturation factor RimP
2	83	SUPERFAMILY	SSF75420	YhbC-like, N-terminal domain
2	83	InterPro	IPR035956	RimP, N-terminal domain superfamily
86	151	Pfam	PF17384	RimP C-terminal SH3 domain
86	151	InterPro	IPR028998	Ribosome maturation factor RimP, C-terminal
21	152	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
88	148	FunFam	G3DSA:2.30.30.180:FF:000004	Ribosome maturation factor RimP
1	20	Phobius	SIGNAL_PEPTIDE	Signal peptide region
17	20	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
84	151	SUPERFAMILY	SSF74942	YhbC-like, C-terminal domain
84	151	InterPro	IPR036847	Ribosome maturation factor RimP, C-terminal domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4746	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.763

PA4746