Overview
Basic information about this protein and its source genome.
- Accession
- PA4747
- Gene
- PA4747 secG
- Status
- annotated
- Amino acids
- 129
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILAAVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSKPAESAGDVPAAPEQK
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
6- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0015450 Primary active carrier-mediated transport of a protein across a membrane, driven by the hydrolysis of the diphosphate bond of inorganic pyrophosphate, ATP, or another nucleoside triphosphate. The transport protein may or may not be transiently phosphorylated, but the substrate is not phosphorylated.
- GO:0065002 The directed movement of proteins in a cell, from one side of a membrane to another by means of some agent such as a transporter or pore.
- GO:0009306 The controlled release of proteins from a cell.
- GO:0043952 The process in which unfolded proteins are transported across the cytoplasmic membrane in Gram-positive and Gram-negative bacteria by the Sec complex, in a process involving proteolytic cleavage of an N-terminal signal peptide.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 29 | 51 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 5 | 23 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 24 | 28 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 5 | 73 | Pfam | PF03840 | Preprotein translocase SecG subunit |
| 5 | 73 | InterPro | IPR004692 | Preprotein translocase SecG subunit |
| 5 | 24 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 5 | 74 | NCBIfam | TIGR00810 | preprotein translocase subunit SecG |
| 5 | 74 | InterPro | IPR004692 | Preprotein translocase SecG subunit |
| 52 | 75 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 28 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 3 | 111 | PANTHER | PTHR34182 | PROTEIN-EXPORT MEMBRANE PROTEIN SECG |
| 3 | 111 | InterPro | IPR004692 | Preprotein translocase SecG subunit |
| 1 | 4 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 76 | 129 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 4 | 24 | PRINTS | PR01651 | Protein-export SecG membrane protein signature |
| 4 | 24 | InterPro | IPR004692 | Preprotein translocase SecG subunit |
| 39 | 55 | PRINTS | PR01651 | Protein-export SecG membrane protein signature |
| 39 | 55 | InterPro | IPR004692 | Preprotein translocase SecG subunit |
| 24 | 38 | PRINTS | PR01651 | Protein-export SecG membrane protein signature |
| 24 | 38 | InterPro | IPR004692 | Preprotein translocase SecG subunit |
| 55 | 77 | PRINTS | PR01651 | Protein-export SecG membrane protein signature |
| 55 | 77 | InterPro | IPR004692 | Preprotein translocase SecG subunit |
| 52 | 74 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 93 | 129 | MobiDBLite | mobidb-lite | consensus disorder prediction |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4747
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.374 | ||||||
| 2 | 0.368 |