Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA4747
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4747 secG
Status: annotated
Amino acids: 129
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0015450 Primary active carrier-mediated transport of a protein across a membrane, driven by the hydrolysis of the diphosphate bond of inorganic pyrophosphate, ATP, or another nucleoside triphosphate. The transport protein may or may not be transiently phosphorylated, but the substrate is not phosphorylated. GO:0065002 The directed movement of proteins in a cell, from one side of a membrane to another by means of some agent such as a transporter or pore. GO:0009306 The controlled release of proteins from a cell. GO:0043952 The process in which unfolded proteins are transported across the cytoplasmic membrane in Gram-positive and Gram-negative bacteria by the Sec complex, in a process involving proteolytic cleavage of an N-terminal signal peptide. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.719

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MLEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILAAVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSKPAESAGDVPAAPEQK

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0015450 Primary active carrier-mediated transport of a protein across a membrane, driven by the hydrolysis of the diphosphate bond of inorganic pyrophosphate, ATP, or another nucleoside triphosphate. The transport protein may or may not be transiently phosphorylated, but the substrate is not phosphorylated.
GO:0065002 The directed movement of proteins in a cell, from one side of a membrane to another by means of some agent such as a transporter or pore.
GO:0009306 The controlled release of proteins from a cell.
GO:0043952 The process in which unfolded proteins are transported across the cytoplasmic membrane in Gram-positive and Gram-negative bacteria by the Sec complex, in a process involving proteolytic cleavage of an N-terminal signal peptide.
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence Features

Domain/signature hits from InterPro and related databases.

24 records

Show feature table

Start	End	DB	Term	Name
29	51	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
5	23	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
24	28	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
5	73	Pfam	PF03840	Preprotein translocase SecG subunit
5	73	InterPro	IPR004692	Preprotein translocase SecG subunit
5	24	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
5	74	NCBIfam	TIGR00810	preprotein translocase subunit SecG
5	74	InterPro	IPR004692	Preprotein translocase SecG subunit
52	75	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	28	Phobius	SIGNAL_PEPTIDE	Signal peptide region
3	111	PANTHER	PTHR34182	PROTEIN-EXPORT MEMBRANE PROTEIN SECG
3	111	InterPro	IPR004692	Preprotein translocase SecG subunit
1	4	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
76	129	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
4	24	PRINTS	PR01651	Protein-export SecG membrane protein signature
4	24	InterPro	IPR004692	Preprotein translocase SecG subunit
39	55	PRINTS	PR01651	Protein-export SecG membrane protein signature
39	55	InterPro	IPR004692	Preprotein translocase SecG subunit
24	38	PRINTS	PR01651	Protein-export SecG membrane protein signature
24	38	InterPro	IPR004692	Preprotein translocase SecG subunit
55	77	PRINTS	PR01651	Protein-export SecG membrane protein signature
55	77	InterPro	IPR004692	Preprotein translocase SecG subunit
52	74	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
93	129	MobiDBLite	mobidb-lite	consensus disorder prediction

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4747	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.374
2				0.368

PA4747