Overview
Basic information about this protein and its source genome.
- Accession
- PA4768
- Gene
- smpB PA4768
- Status
- annotated
- Amino acids
- 159
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MAKQKKHPSGTIAQNKKALHDYFIEQRFEAGVALAGWEVKSLRAGKAQLVDSYVLLKDGEAWLLGSHITPLTTASTHVIADPVRTRKLLLHKRELGKLFGAVQQKGYACVALSMYWKKHLVKCEIALAKGKKDFDKRHTEKERDSDREIQRAMRHGKDD
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0003723 Binding to an RNA molecule or a portion thereof.
- GO:0070929 A translational elongation process in which transfer of a translating ribosome from one mRNA to another RNA template takes place. Trans-translation occurs during tmRNA release of stalled ribosomes.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 12 | 154 | Pfam | PF01668 | SmpB protein |
| 12 | 154 | InterPro | IPR000037 | SsrA-binding protein |
| 1 | 159 | Hamap | MF_00023 | SsrA-binding protein [smpB]. |
| 1 | 159 | InterPro | IPR000037 | SsrA-binding protein |
| 4 | 133 | Gene3D | G3DSA:2.40.280.10 | - |
| 4 | 133 | InterPro | IPR023620 | Small protein B |
| 136 | 159 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 12 | 154 | NCBIfam | TIGR00086 | SsrA-binding protein |
| 5 | 136 | SUPERFAMILY | SSF74982 | Small protein B (SmpB) |
| 5 | 136 | InterPro | IPR023620 | Small protein B |
| 15 | 131 | CDD | cd09294 | SmpB |
| 15 | 131 | InterPro | IPR000037 | SsrA-binding protein |
| 30 | 42 | ProSitePatterns | PS01317 | SsrA-binding protein. |
| 30 | 42 | InterPro | IPR020081 | SsrA-binding protein, conserved site |
| 1 | 155 | PANTHER | PTHR30308 | TMRNA-BINDING COMPONENT OF TRANS-TRANSLATION TAGGING COMPLEX |
| 1 | 155 | InterPro | IPR000037 | SsrA-binding protein |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4768
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 3 | 0.739 | ||||||
| 5 | 0.36 | ||||||
| 1 | 0.324 |