Protein profile

PA4771

L-lactate dehydrogenase

Genome: NC_002516.2

Gene: lldD PA4771 Structure source: AlphaFold UniProt Q9HV37
Amino acids 381
Annotations 8
Features 19
PDB binders 41
Druggability 0.682

Overview

Basic information about this protein and its source genome.

Accession
PA4771
Gene
lldD PA4771
Status
annotated
Amino acids
381
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
35.925
Human E-value
1.01e-69
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.682
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MIISASTDYRAAAQRKLPPFLFHYIDGGAYAEYTLRRNVEDLSAIALRQRVLKNMSELSLETRLFDETLAMPVALAPVGLTGMYARRGEVQAARAAAAKGVPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAKAAGVTTLVFTVDMPVPGARYRDAHSGMSGPYAAPRRILQAMTHPAWAWDVGLLGKPHDLGNISAYRGNPTGLEDYIGWLGANFDPSISWKDLEWIREFWDGPMVIKGILDPEDARDAVKFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGELAILADSGIRTGLDVVRMIALGADSVLLGRAFVYALAAAGEAGVRNLLELIEKEMRVAMVLTGAKSIGEISADSLVRELGA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0010181 Binding to flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
  • GO:0004459 Catalysis of the reaction: (S)-lactate + NAD+ = pyruvate + NADH + H+.
  • GO:0009060 The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which requires oxygen as the terminal electron acceptor.
  • GO:0006089 The chemical reactions and pathways involving lactate, the anion of lactic acid.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0004457 Catalysis of the reaction: lactate + NAD+ = H+ + NADH + pyruvate.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
5 376 PANTHER PTHR10578 S -2-HYDROXY-ACID OXIDASE-RELATED
1 380 Hamap MF_01559 L-lactate dehydrogenase [lldD].
1 380 InterPro IPR020920 L-lactate dehydrogenase, bacterial
273 279 ProSitePatterns PS00557 FMN-dependent alpha-hydroxy acid dehydrogenases active site.
273 279 InterPro IPR008259 FMN-dependent alpha-hydroxy acid dehydrogenase, active site
2 379 PIRSF PIRSF000138 Al-hdrx_acd_dh
2 379 InterPro IPR012133 Alpha-hydroxy acid dehydrogenase, FMN-dependent
1 380 ProSiteProfiles PS51349 FMN-dependent alpha-hydroxy acid dehydrogenase domain profile.
1 380 InterPro IPR037396 FMN hydroxy acid dehydrogenase domain
8 371 CDD cd02809 alpha_hydroxyacid_oxid_FMN
8 371 InterPro IPR012133 Alpha-hydroxy acid dehydrogenase, FMN-dependent
7 374 SUPERFAMILY SSF51395 FMN-linked oxidoreductases
1 377 NCBIfam NF033901 FMN-dependent L-lactate dehydrogenase LldD
1 377 InterPro IPR020920 L-lactate dehydrogenase, bacterial
2 380 FunFam G3DSA:3.20.20.70:FF:000029 L-lactate dehydrogenase
13 375 Pfam PF01070 FMN-dependent dehydrogenase
13 375 InterPro IPR000262 FMN-dependent dehydrogenase
3 379 Gene3D G3DSA:3.20.20.70 Aldolase class I
3 379 InterPro IPR013785 Aldolase-type TIM barrel

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4771
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
4 0.682
1 0.64
10 0.227

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

191 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
173 O52792 150.1 Da LogP 0.95 TPSA 54.4 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)C(=O)O
2OP O52792 90.1 Da LogP -0.55 TPSA 57.5 ✓ Ro5 ✓ Clean C[C@@H](C(=O)O)O
3IL P20932 205.2 Da LogP 1.16 TPSA 73.3 ✓ Ro5 ✓ Clean c1ccc2c(c1)c(c[nH]2)C[C@@H](C(=O)O)O
9NL O52792 202.2 Da LogP 1.22 TPSA 57.5 ✓ Ro5 ✓ Clean c1ccc(cc1)C([C@@H](C(=O)O)O)(F)F
9NO O52792 218.2 Da LogP 0.54 TPSA 77.8 ✓ Ro5 ✓ Clean c1ccc(cc1)C(C(C(=O)O)(O)O)(F)F
9O0 O52792 144.0 Da LogP -0.01 TPSA 57.5 ✓ Ro5 ✓ Clean [C@@H](C(=O)O)(C(F)(F)F)O
9O3 O52792 160.0 Da LogP -0.69 TPSA 77.8 ✓ Ro5 ✓ Clean C(=O)(C(C(F)(F)F)(O)O)O
9O6 O52792 184.2 Da LogP 1.14 TPSA 57.5 ✓ Ro5 ✓ Clean c1ccc(cc1)[C@@H]([C@@H](C(=O)O)O)F
9O9 O52792 455.4 Da LogP -1.00 TPSA 195.2 1 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=C2)C[C@@H]([C@…
9OC O52792 576.5 Da LogP 0.23 TPSA 216.7 2 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=C(N2C[C@@H]([C@@H]([C@@H](COP…
9OR O52792 544.4 Da LogP -1.54 TPSA 254.0 2 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=C(N2C[C@@H]([C@@H]([C@@H](COP…
9OU O52792 562.5 Da LogP 0.30 TPSA 216.7 2 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=C(N2C[C@@H]([C@@H]([C@@H](COP…
9P3 O52792 515.4 Da LogP -1.54 TPSA 218.8 2 viol. ✓ Clean Cc1cc2c(cc1C)[N@@+]3([C@]4(O3)C(=O)NC(=O)N=C4N2…
9P9 O52792 606.5 Da LogP -1.84 TPSA 274.2 3 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=C(N2C[C@@H]([C@@H]([C@@H](COP…
9PX O52792 548.4 Da LogP -1.21 TPSA 246.0 3 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)[C@@]3(N2)OOC(=O)…
9Q0 O52792 607.5 Da LogP -3.07 TPSA 264.2 2 viol. ✓ Clean Cc1cc2c(cc1C)[n+](c3c([n+]2C[C@@H]([C@@H]([C@@H…
9Q6 O52792 474.4 Da LogP -1.94 TPSA 221.5 1 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)[C@@]3(N2)O)C[C@@…
9QF O52792 490.4 Da LogP -1.44 TPSA 230.7 2 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)[C@@]3(N2)OO)C[C@…
9RW O52792 150.2 Da LogP 1.87 TPSA 37.3 ✓ Ro5 ✓ Clean C[C@@H](c1ccccc1)C(=O)O
B8C O52792 604.4 Da LogP -1.97 TPSA 305.3 3 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)[C@@]3(N2)O/C(=C(…
BEZ O52792 122.1 Da LogP 1.38 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)O
C7C Q9UJM8 271.7 Da LogP 1.71 TPSA 65.9 ✓ Ro5 ✓ Clean c1cc(ccc1Sc2c(nns2)C(=O)[O-])Cl
F7C O52792 148.1 Da LogP -1.91 TPSA 111.9 ✓ Ro5 ✓ Clean [C@H](C(=O)C(=O)O)(C(=O)O)O
F7F O52792 472.3 Da LogP -1.59 TPSA 204.8 1 viol. ✓ Clean Cc1cc2c(cc1C)N3[C@@]4(O3)C(=O)NC(=O)N=C4N2C[C@H…
FNR Q9UJM8 458.4 Da LogP -0.93 TPSA 208.4 1 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=C(N2)C(=O)NC(=O)N3)C[C@@H]([C…
GLV Q9UJM8 74.0 Da LogP -0.73 TPSA 54.4 ✓ Ro5 ✓ Clean C(=O)C(=O)O
GOA Q9UJM8 76.1 Da LogP -0.94 TPSA 57.5 ✓ Ro5 ✓ Clean C(C(=O)O)O
HBX O52792 106.1 Da LogP 1.50 TPSA 17.1 ✓ Ro5 ✓ Clean c1ccc(cc1)C=O
HFA O52792 166.2 Da LogP 0.67 TPSA 57.5 ✓ Ro5 ✓ Clean c1ccc(cc1)C[C@@H](C(=O)O)O
HHH O52792 168.1 Da LogP 0.51 TPSA 77.8 ✓ Ro5 ✓ Clean c1cc(ccc1[C@@H](C(=O)O)O)O
HOC P20932 160.2 Da LogP 1.40 TPSA 57.5 ✓ Ro5 ✓ Clean CCCCCC[C@@H](C(=O)O)O
LMT P20932 510.6 Da LogP -0.45 TPSA 178.5 3 viol. ✓ Clean CCCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1…
PAC O52792 136.1 Da LogP 1.31 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)CC(=O)O
PPY O52792 164.2 Da LogP 0.88 TPSA 54.4 ✓ Ro5 ✓ Clean c1ccc(cc1)CC(=O)C(=O)O
PYR O52792 88.1 Da LogP -0.34 TPSA 54.4 ✓ Ro5 ✓ Clean CC(=O)C(=O)O
RMN O52792 152.1 Da LogP 0.80 TPSA 57.5 ✓ Ro5 ✓ Clean c1ccc(cc1)[C@H](C(=O)O)O
SL7 Q9UJM8 394.4 Da LogP 2.69 TPSA 140.4 ✓ Ro5 Alert CN(C)c1nc(on1)c2cccc(c2O)CNc3ccc4c(c3)c([nH]n4)…
SLG Q9UJM8 471.3 Da LogP 6.25 TPSA 73.4 1 viol. ✓ Clean CN(Cc1ccc(cc1c2ccc(c(c2)Cl)C(=O)O)F)C(=O)c3cc4c…
SLJ Q9UJM8 340.4 Da LogP 3.08 TPSA 91.3 ✓ Ro5 ✓ Clean CCCOc1c(cccn1)CN(C)c2ccc3c(c2)c([nH]n3)C(=O)O
SMN O52792 152.1 Da LogP 0.80 TPSA 57.5 ✓ Ro5 ✓ Clean c1ccc(cc1)[C@@H](C(=O)O)O
YOJ Q9UJM8 733.7 Da LogP 5.44 TPSA 216.3 3 viol. ✓ Clean c1cc(ccc1c2cc(ccc2F)c3c(c(n(n3)c4nc(cs4)C(=O)O)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.