Protein profile

PA4806

transcriptional regulator

Genome: NC_002516.2

Gene: PA4806 Structure source: AlphaFold UniProt Q9HV03
Export view
Amino acids 227
Annotations 3
Features 19
PDB binders 0
Druggability 0.638

Overview

Basic information about this protein and its source genome.

Accession
PA4806
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA4806
Status
annotated
Amino acids
227
Structure source
AlphaFold
GO
GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.638
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MISLERKGHAPTLLYERGIAERFREAIIRRYFSRGYLLDPFCLAVEEGLPEGFYTLGEIAPDDFFQSAYYQTYYLGAGAVEDVYYILDLGPTEKLSICLYNGLSASRYSDAQVAALAGLAPPVLELARQFCAGRADLSPNPQADLAPRLQEVLRGFGRGVLTDREREACHLLLSGHSAKSSARLMDISPETVRMHRKNLYTKLEVGSQSELFALFIECLSQGQRVGP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
158 215 SMART SM00421 luxrmega5
158 215 InterPro IPR000792 Transcription regulator LuxR, C-terminal
108 220 Gene3D G3DSA:1.10.10.10 -
108 220 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
157 217 SUPERFAMILY SSF46894 C-terminal effector domain of the bipartite response regulators
157 217 InterPro IPR016032 Signal transduction response regulator, C-terminal effector
161 217 CDD cd06170 LuxR_C_like
161 217 InterPro IPR000792 Transcription regulator LuxR, C-terminal
154 219 ProSiteProfiles PS50043 LuxR-type HTH domain profile.
154 219 InterPro IPR000792 Transcription regulator LuxR, C-terminal
161 175 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
161 175 InterPro IPR000792 Transcription regulator LuxR, C-terminal
175 191 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
175 191 InterPro IPR000792 Transcription regulator LuxR, C-terminal
191 203 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
191 203 InterPro IPR000792 Transcription regulator LuxR, C-terminal
96 215 PANTHER PTHR44688 -
160 213 Pfam PF00196 Bacterial regulatory proteins, luxR family
160 213 InterPro IPR000792 Transcription regulator LuxR, C-terminal

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4806
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
4 0.638
1 0.627