Protein profile

PA4819

glycosyl transferase family protein

Genome: NC_002516.2

Gene: PA4819 Structure source: AlphaFold UniProt Q9HUZ1
Amino acids 324
Annotations 2
Features 16
PDB binders 3
Druggability 0.679

Overview

Basic information about this protein and its source genome.

Accession
PA4819
Gene
PA4819
Status
annotated
Amino acids
324
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
29.524
Human E-value
1.31e-08
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.679
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MMIEPSLASKLEAPCLLSVVVPVFNEEAVLPAFHQRLGAVLGDLGDDCEVLYVDDGSTDRSAAILAQLQAADRRVGVARFTRNFGKEQAMSAGLKLSRGAAVIVIDADLQDPPELIPQMLDAWIGGAEMVNMRRRSRAGESWLKRASASAFYRLINRLSEVPIPRDVGDFRLLDRRVVDALCELPEGNRFMKGLFAWVGFRQVDIAYSRAARVAGHSKWRYWRLWNFALEGITGFSTAPLKVAGYLGLLSLLAALATLLAGIFGQQEIHEHWPVIAALFLIGGLQLLAIGVCSEYLGRMTMEARRRPLYLIDRYLPAQVGGANP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0016757 Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
18 179 InterPro IPR001173 Glycosyltransferase 2-like
19 200 CDD cd04187 DPM1_like_bac
17 275 SUPERFAMILY SSF53448 Nucleotide-diphospho-sugar transferases
17 275 InterPro IPR029044 Nucleotide-diphospho-sugar transferases
275 296 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
3 229 Gene3D G3DSA:3.90.550.10 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
3 229 InterPro IPR029044 Nucleotide-diphospho-sugar transferases
13 315 PANTHER PTHR48090 UNDECAPRENYL-PHOSPHATE 4-DEOXY-4-FORMAMIDO-L-ARABINOSE TRANSFERASE-RELATED
18 179 Pfam PF00535 Glycosyl transferase family 2
1 241 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
242 264 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
10 221 FunFam G3DSA:3.90.550.10:FF:000079 Probable glycosyl transferase
297 324 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
274 296 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
264 274 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
242 263 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4819
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
7 0.679
1 0.652

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
GDD Q8U4M3 605.3 Da LogP -4.63 TPSA 331.7 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
LDA Q8U4M3 229.4 Da LogP 4.48 TPSA 23.1 ✓ Ro5 ✓ Clean CCCCCCCCCCCC[N+](C)(C)[O-]
MJC Q8U4M3 1011.5 Da LogP 16.23 TPSA 145.9 2 viol. ✓ Clean C[C@H](CCC=C(C)CCC=C(C)CC/C=C(\C)/CC/C=C(\C)/CC…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.