Protein profile

PA4847

acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

Genome: NC_002516.2

Gene: fabE accB PA4847 Structure source: AlphaFold UniProt P37799
Export view
Amino acids 156
Annotations 3
Features 20
PDB binders 0
Druggability 0.669

Overview

Basic information about this protein and its source genome.

Accession
PA4847
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
fabE accB PA4847
Status
annotated
Amino acids
156
Structure source
AlphaFold
GO
GO:0009317 A protein complex that catalyzes the first step in long-chain fatty acid biosynthesis. For example, in E. coli the complex is heterohexameric and composed of biotin carbonyl carrier protein, biotin carboxylase and the acetate CoA-transferase complex. GO:0003989 Catalysis of the reaction: ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA. GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.669
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MDIRKVKKLIELLEESGIDELEIREGEESVRISRHSKTAAQPVYAQAPAFAAPVAAPAPAAAAPAAAAAESAPAAPKLNGNVVRSPMVGTFYRAASPTSANFVEVGQSVKKGDILCIVEAMKMMNHIEAEVSGTIESILVENGQPVEFDQPLFTIV

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0009317 A protein complex that catalyzes the first step in long-chain fatty acid biosynthesis. For example, in E. coli the complex is heterohexameric and composed of biotin carbonyl carrier protein, biotin carboxylase and the acetate CoA-transferase complex.
  • GO:0003989 Catalysis of the reaction: ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA.
  • GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
77 155 Gene3D G3DSA:2.40.50.100 -
74 156 FunFam G3DSA:2.40.50.100:FF:000003 Acetyl-CoA carboxylase biotin carboxyl carrier protein
80 156 ProSiteProfiles PS50968 Biotinyl/lipoyl domain profile.
80 156 InterPro IPR000089 Biotin/lipoyl attachment
80 155 SUPERFAMILY SSF51230 Single hybrid motif
80 155 InterPro IPR011053 Single hybrid motif
102 116 PRINTS PR01071 Acetyl-CoA biotin carboxyl carrier protein signature
102 116 InterPro IPR001249 Acetyl-CoA biotin carboxyl carrier
85 98 PRINTS PR01071 Acetyl-CoA biotin carboxyl carrier protein signature
85 98 InterPro IPR001249 Acetyl-CoA biotin carboxyl carrier
117 130 PRINTS PR01071 Acetyl-CoA biotin carboxyl carrier protein signature
117 130 InterPro IPR001249 Acetyl-CoA biotin carboxyl carrier
82 155 CDD cd06850 biotinyl_domain
112 129 ProSitePatterns PS00188 Biotin-requiring enzymes attachment site.
112 129 InterPro IPR001882 Biotin-binding site
1 155 NCBIfam TIGR00531 acetyl-CoA carboxylase biotin carboxyl carrier protein
1 155 InterPro IPR001249 Acetyl-CoA biotin carboxyl carrier
20 155 PANTHER PTHR45266 OXALOACETATE DECARBOXYLASE ALPHA CHAIN
82 155 Pfam PF00364 Biotin-requiring enzyme
82 155 InterPro IPR000089 Biotin/lipoyl attachment

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4847
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.669