Protein profile

PA4865

urease subunit gamma

Genome: NC_002516.2

Gene: PA4865 ureA Structure source: AlphaFold UniProt Q9HUU8

Export view

Amino acids 100

Annotations 6

Features 18

PDB binders 2

Druggability 0.65

Overview

Basic information about this protein and its source genome.

Accession: PA4865
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4865 ureA
Status: annotated
Amino acids: 100
Structure source: AlphaFold

3.5.1.5

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. GO:0016151 Binding to a nickel (Ni) cation. GO:0009039 Catalysis of the reaction: urea + 2 H2O + H+ = hydrogencarbonate + 2 NH4+. GO:0043419 The chemical reactions and pathways resulting in the breakdown of urea, the water soluble compound O=C-(NH2)2. GO:0019627 The chemical reactions and pathways involving urea, the water soluble compound O=C-(NH2)2.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.65

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MDLSPREKDKLLIFTAGLLAERRLARGLKLNYPEAVALISAALLEGARDGRSVAELMHYGTTLLNREQVMEGVPEMIPDIQVEATFPDGTKLVTVHQPIA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

3.5.1.5

Gene Ontology (GO)

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
GO:0016151 Binding to a nickel (Ni) cation.
GO:0009039 Catalysis of the reaction: urea + 2 H2O + H+ = hydrogencarbonate + 2 NH4+.
GO:0043419 The chemical reactions and pathways resulting in the breakdown of urea, the water soluble compound O=C-(NH2)2.
GO:0019627 The chemical reactions and pathways involving urea, the water soluble compound O=C-(NH2)2.

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records

Show feature table

Start	End	DB	Term	Name
1	27	Phobius	SIGNAL_PEPTIDE	Signal peptide region
1	100	PANTHER	PTHR33569	UREASE
1	10	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
4	99	CDD	cd00390	Urease_gamma
4	99	InterPro	IPR002026	Urease, gamma/gamma-beta subunit
1	100	Hamap	MF_00739	Urease subunit gamma [ureA].
1	100	InterPro	IPR012010	Urease, gamma subunit
1	100	Gene3D	G3DSA:3.30.280.10	-
1	100	InterPro	IPR036463	Urease, gamma subunit superfamily
28	100	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1	99	SUPERFAMILY	SSF54111	Urease, gamma-subunit
1	99	InterPro	IPR036463	Urease, gamma subunit superfamily
1	99	NCBIfam	TIGR00193	urease subunit gamma
1	99	InterPro	IPR002026	Urease, gamma/gamma-beta subunit
20	27	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
1	100	PIRSF	PIRSF001223	Urease_gamma
1	99	Pfam	PF00547	Urease, gamma subunit
11	19	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4865	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.65

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
DBX	5FSD	P41022	190.2 Da LogP 0.34 TPSA 94.8	✓ Ro5	✓ Clean	`c1cc(c(cc1O)S(=O)(=O)O)O`
HQE	5FSE	P41022	110.1 Da LogP 1.10 TPSA 40.5	✓ Ro5	✓ Clean	`c1cc(ccc1O)O`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC13558894	0.727	262.3 Da LogP 4.43 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(-c2ccc(-c3ccc(O)cc3)cc2)cc1`
ZINC1700194	0.654	254.2 Da LogP -0.11 TPSA 129.0	✓ Ro5	✓ Clean	`O=S(=O)(O)c1ccc(O)c(S(=O)(=O)O)c1`
ZINC2570177	0.630	208.6 Da LogP 1.29 TPSA 74.6	✓ Ro5	✓ Clean	`O=S(=O)(O)c1cc(Cl)ccc1O`
ZINC391103	0.615	220.0 Da LogP 2.00 TPSA 20.2	✓ Ro5	✓ Clean	`Oc1ccc(I)cc1`
ZINC1601787	0.609	270.2 Da LogP -0.41 TPSA 149.2	✓ Ro5	✓ Clean	`O=S(=O)(O)c1cc(O)c(S(=O)(=O)O)cc1O`
ZINC1621206	0.607	230.3 Da LogP 1.94 TPSA 74.6	✓ Ro5	✓ Clean	`CC(C)(C)c1ccc(O)c(S(=O)(=O)O)c1`
ZINC2510090	0.586	202.2 Da LogP 0.45 TPSA 91.7	✓ Ro5	✓ Clean	`O=Cc1ccc(O)c(S(=O)(=O)O)c1`
ZINC34049542	0.583	270.2 Da LogP -0.41 TPSA 149.2	✓ Ro5	✓ Clean	`O=S(=O)(O)c1cc(S(=O)(=O)O)c(O)cc1O`
ZINC12428972	0.571	214.2 Da LogP 3.51 TPSA 65.2	✓ Ro5	Alert	`Oc1ccc(/N=N/c2ccc(O)cc2)cc1`
ZINC13319959	0.571	212.2 Da LogP 3.27 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(/C=C\c2ccc(O)cc2)cc1`
ZINC136152	0.571	200.2 Da LogP 2.69 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(Cc2ccc(O)cc2)cc1`
ZINC136154	0.571	218.3 Da LogP 3.25 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(Sc2ccc(O)cc2)cc1`
ZINC1510311	0.571	212.2 Da LogP 3.27 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(/C=C/c2ccc(O)cc2)cc1`
ZINC1562031	0.571	214.3 Da LogP 2.88 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(CCc2ccc(O)cc2)cc1`
ZINC1627219	0.571	208.6 Da LogP 1.29 TPSA 74.6	✓ Ro5	✓ Clean	`O=S(=O)(O)c1ccc(O)cc1Cl`
ZINC186362	0.571	201.2 Da LogP 2.84 TPSA 52.5	✓ Ro5	✓ Clean	`Oc1ccc(Nc2ccc(O)cc2)cc1`
ZINC1875408805	0.571	212.2 Da LogP 3.27 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(C=Cc2ccc(O)cc2)cc1`
ZINC254488515	0.571	214.2 Da LogP 3.51 TPSA 65.2	✓ Ro5	Alert	`Oc1ccc(N=Nc2ccc(O)cc2)cc1`
ZINC283706	0.571	294.3 Da LogP 4.68 TPSA 58.9	✓ Ro5	✓ Clean	`Oc1ccc(Oc2ccc(Oc3ccc(O)cc3)cc2)cc1`
ZINC2924369	0.571	242.2 Da LogP 2.16 TPSA 74.6	✓ Ro5	Alert	`O=C(C(=O)c1ccc(O)cc1)c1ccc(O)cc1`
ZINC33961815	0.571	210.2 Da LogP 2.50 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(C#Cc2ccc(O)cc2)cc1`
ZINC39365182	0.571	384.4 Da LogP 4.89 TPSA 80.9	✓ Ro5	✓ Clean	`Oc1ccc(C(c2ccc(O)cc2)(c2ccc(O)cc2)c2ccc(O)cc2)c…`
ZINC394643	0.571	202.2 Da LogP 2.89 TPSA 49.7	✓ Ro5	✓ Clean	`Oc1ccc(Oc2ccc(O)cc2)cc1`
ZINC4887214	0.571	292.3 Da LogP 3.98 TPSA 60.7	✓ Ro5	✓ Clean	`Oc1ccc(C(c2ccc(O)cc2)c2ccc(O)cc2)cc1`
ZINC4963136	0.571	311.4 Da LogP 3.90 TPSA 60.7	✓ Ro5	✓ Clean	`Oc1ccc([S+](c2ccc(O)cc2)c2ccc(O)cc2)cc1`
ZINC15768845	0.567	422.4 Da LogP 2.17 TPSA 149.2	✓ Ro5	✓ Clean	`O=S(=O)(c1cccc(S(=O)(=O)c2cc(O)ccc2O)c1)c1cc(O)…`
ZINC15769684	0.567	498.5 Da LogP 3.84 TPSA 149.2	✓ Ro5	✓ Clean	`O=S(=O)(c1ccc(-c2ccc(S(=O)(=O)c3cc(O)ccc3O)cc2)…`
ZINC36686	0.567	250.3 Da LogP 1.93 TPSA 74.6	✓ Ro5	✓ Clean	`O=S(=O)(c1ccccc1)c1cc(O)ccc1O`
ZINC1724272	0.548	219.2 Da LogP 0.55 TPSA 117.7	✓ Ro5	✓ Clean	`O=[N+]([O-])c1ccc(O)c(S(=O)(=O)O)c1`
ZINC1691305	0.538	320.3 Da LogP 0.74 TPSA 149.2	✓ Ro5	✓ Clean	`O=S(=O)(O)c1cc2cc(S(=O)(=O)O)c(O)cc2cc1O`
ZINC1306	0.533	240.3 Da LogP 4.05 TPSA 40.5	✓ Ro5	✓ Clean	`C/C(=C(/C)c1ccc(O)cc1)c1ccc(O)cc1`
ZINC2034791	0.533	240.3 Da LogP 4.05 TPSA 40.5	✓ Ro5	✓ Clean	`C/C(=C(\C)c1ccc(O)cc1)c1ccc(O)cc1`
ZINC28449	0.533	214.2 Da LogP 2.33 TPSA 57.5	✓ Ro5	✓ Clean	`O=C(c1ccc(O)cc1)c1ccc(O)cc1`
ZINC332365	0.533	318.3 Da LogP 3.56 TPSA 74.6	✓ Ro5	✓ Clean	`O=C(c1ccc(O)cc1)c1ccc(C(=O)c2ccc(O)cc2)cc1`
ZINC4327575	0.533	212.2 Da LogP 3.16 TPSA 40.5	✓ Ro5	✓ Clean	`C=C(c1ccc(O)cc1)c1ccc(O)cc1`
ZINC1760471	0.531	265.3 Da LogP 1.51 TPSA 100.6	✓ Ro5	✓ Clean	`Nc1ccc(S(=O)(=O)c2cc(O)ccc2O)cc1`
ZINC257795	0.531	284.7 Da LogP 2.58 TPSA 74.6	✓ Ro5	✓ Clean	`O=S(=O)(c1ccc(Cl)cc1)c1cc(O)ccc1O`
ZINC36613	0.531	264.3 Da LogP 2.24 TPSA 74.6	✓ Ro5	✓ Clean	`Cc1ccc(S(=O)(=O)c2cc(O)ccc2O)cc1`
ZINC366453	0.531	329.2 Da LogP 2.69 TPSA 74.6	✓ Ro5	✓ Clean	`O=S(=O)(c1ccc(Br)cc1)c1cc(O)ccc1O`
ZINC2187161	0.516	224.2 Da LogP 1.79 TPSA 74.6	✓ Ro5	✓ Clean	`O=S(=O)(O)c1cccc2cc(O)ccc12`
ZINC104366597	0.515	278.3 Da LogP 3.05 TPSA 99.3	✓ Ro5	Alert	`O=S(=O)(O)c1cc(/N=N\c2ccccc2)ccc1O`
ZINC1719266	0.515	265.3 Da LogP 1.90 TPSA 86.6	✓ Ro5	✓ Clean	`O=S(=O)(Nc1ccccc1)c1cc(O)ccc1O`
ZINC4804116	0.515	278.3 Da LogP 3.05 TPSA 99.3	✓ Ro5	Alert	`O=S(=O)(O)c1cc(/N=N/c2ccccc2)ccc1O`
ZINC113289810	0.500	357.4 Da LogP 3.99 TPSA 99.4	✓ Ro5	✓ Clean	`Oc1ccc(-c2nc(-c3ccc(O)cc3)nc(-c3ccc(O)cc3)n2)cc1`
ZINC1577151	0.500	304.3 Da LogP 1.04 TPSA 129.0	✓ Ro5	✓ Clean	`O=S(=O)(O)c1cc(S(=O)(=O)O)c2cc(O)ccc2c1`
ZINC1700211	0.500	224.2 Da LogP 1.79 TPSA 74.6	✓ Ro5	✓ Clean	`O=S(=O)(O)c1cccc2ccc(O)cc12`
ZINC2529860	0.500	286.2 Da LogP 3.98 TPSA 40.5	✓ Ro5	✓ Clean	`Oc1ccc(C(F)(F)C(F)(F)c2ccc(O)cc2)cc1`
ZINC257798	0.500	278.3 Da LogP 2.55 TPSA 74.6	✓ Ro5	✓ Clean	`Cc1ccc(S(=O)(=O)c2cc(O)ccc2O)cc1C`
ZINC2579046	0.500	296.1 Da LogP 3.66 TPSA 20.2	✓ Ro5	✓ Clean	`Oc1ccc(-c2ccc(I)cc2)cc1`
ZINC27646236	0.500	278.3 Da LogP 4.14 TPSA 60.7	✓ Ro5	✓ Clean	`Oc1ccc(-c2ccc(-c3cc(O)cc(O)c3)cc2)cc1`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.