Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA4891
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: ureE PA4891
Status: annotated
Amino acids: 167
Structure source: AlphaFold

GO

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. GO:0016151 Binding to a nickel (Ni) cation. GO:0051082 Binding to an unfolded protein. GO:0006457 The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure. GO:0065003 The aggregation, arrangement and bonding together of a set of macromolecules to form a protein-containing complex. GO:0019627 The chemical reactions and pathways involving urea, the water soluble compound O=C-(NH2)2.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.692

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MLVIHQRLPARSPRWDEELHLTYEARSKSRLRCFAASGEEVGLFLERGQPPLADGDCLEARDGRLVRVVARSERLLHVTCASPLELTRAAYHLGNRHVALQVGDGWLRLLDDYVLKAMLEQLGATVEAIEAPFQPEHGAYGGGHHHSHHGEAEFNYAPRLHQFGVRR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
GO:0016151 Binding to a nickel (Ni) cation.
GO:0051082 Binding to an unfolded protein.
GO:0006457 The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
GO:0065003 The aggregation, arrangement and bonding together of a set of macromolecules to form a protein-containing complex.
GO:0019627 The chemical reactions and pathways involving urea, the water soluble compound O=C-(NH2)2.

Sequence Features

Domain/signature hits from InterPro and related databases.

17 records

Show feature table

Start	End	DB	Term	Name
1	66	SMART	SM00988	UreE_n_2_a
1	66	InterPro	IPR004029	UreE urease accessory, N-terminal
73	139	SUPERFAMILY	SSF69737	Urease metallochaperone UreE, C-terminal domain
17	133	CDD	cd00571	UreE
17	133	InterPro	IPR012406	Urease accessory protein UreE
5	66	Pfam	PF02814	UreE urease accessory protein, N-terminal domain
5	66	InterPro	IPR004029	UreE urease accessory, N-terminal
1	71	Gene3D	G3DSA:2.60.260.20	-
73	142	Gene3D	G3DSA:3.30.70.790	-
1	71	SUPERFAMILY	SSF69287	Urease metallochaperone UreE, N-terminal domain
1	71	InterPro	IPR036118	UreE urease accessory, N-terminal domain superfamily
1	151	PIRSF	PIRSF036402	Ureas_acces_UreE
1	151	InterPro	IPR012406	Urease accessory protein UreE
73	150	Pfam	PF05194	UreE urease accessory protein, C-terminal domain
73	150	InterPro	IPR007864	Urease accessory protein UreE, C-terminal domain
2	140	Hamap	MF_00822	Urease accessory protein UreE [ureE].
2	140	InterPro	IPR012406	Urease accessory protein UreE

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4891	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
3				0.692
2				0.202

PA4891