Protein profile

PA4893

urease accessory protein UreG

Genome: NC_002516.2

Gene: PA4893 ureG Structure source: AlphaFold UniProt Q9HUS0
Amino acids 204
Annotations 10
Features 17
PDB binders 1
Druggability 0.69

Overview

Basic information about this protein and its source genome.

Accession
PA4893
Gene
PA4893 ureG
Status
annotated
Amino acids
204
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.69
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTSQPLRVGIGGPVGSGKTALTLALCRELRERYNLAVVTNDIYTQEDAEFLVRNEALAPERIIGVETGGCPHTAIREDASINLEAVDQLNRRFPGLELILVESGGDNLSATFSPELSDLTLYVIDVSAGDKIPRKGGPGICKSDLLVINKIDLAPLVGASLDVMDRDARRMRGDKPFVFSNQKTGQGLDEIIAFIERQGLLTAA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

10 GO

Gene Ontology (GO)

10
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0005525 Binding to GTP, guanosine triphosphate.
  • GO:0003924 Catalysis of the reaction: GTP + H2O = GDP + H+ + phosphate.
  • GO:0016151 Binding to a nickel (Ni) cation.
  • GO:0018237 Increases the activity of urease by promoting the incorporation of nickel into the active site.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0043419 The chemical reactions and pathways resulting in the breakdown of urea, the water soluble compound O=C-(NH2)2.
  • GO:0019627 The chemical reactions and pathways involving urea, the water soluble compound O=C-(NH2)2.
  • GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
  • GO:0006807 OBSOLETE. The chemical reactions and pathways involving organic or inorganic compounds that contain nitrogen.

Sequence Features

Domain/signature hits from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
4 202 Hamap MF_01389 Urease accessory protein UreG [ureG].
4 202 InterPro IPR004400 Urease accessory protein UreG
3 197 PANTHER PTHR31715 UREASE ACCESSORY PROTEIN G
3 197 InterPro IPR004400 Urease accessory protein UreG
8 178 Pfam PF02492 CobW/HypB/UreG, nucleotide-binding domain
8 178 InterPro IPR003495 CobW/HypB/UreG, nucleotide-binding domain
2 203 PIRSF PIRSF005624 Ni-bind_GTPase
3 201 FunFam G3DSA:3.40.50.300:FF:000208 Urease accessory protein UreG
6 196 CDD cd05540 UreG
4 183 SMART SM00382 AAA_5
4 183 InterPro IPR003593 AAA+ ATPase domain
3 202 Gene3D G3DSA:3.40.50.300 -
3 202 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
6 201 NCBIfam TIGR00101 urease accessory protein UreG
6 201 InterPro IPR004400 Urease accessory protein UreG
3 197 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
3 197 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4893
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.69

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
GSP Q57884 539.2 Da LogP -2.22 TPSA 282.0 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.