Protein profile

PA4950

hypothetical protein

Genome: NC_002516.2

Gene: queG PA4950 Structure source: AlphaFold UniProt Q9HUL4
Export view
Amino acids 361
Annotations 8
Features 16
PDB binders 0
Druggability 0.699

Overview

Basic information about this protein and its source genome.

Accession
PA4950
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
queG PA4950
Status
annotated
Amino acids
361
Structure source
AlphaFold
EC
1.17.99.6
GO
GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. GO:0052693 Catalysis of the reaction: epoxyqueuosine in tRNA + reductant = queuosine in tRNA + oxidised reductant. GO:0046872 Binding to a metal ion. GO:0008616 The chemical reactions and pathways resulting in the formation of queuosines, a series of nucleosides found in position 34 of tRNA and having an additional pentenyl ring added via an NH group to the methyl group of 7-methylguanosine. The pentenyl ring may carry other substituents. The wobble nucleoside of the tRNA sequence (position 34) corresponds to the first position of the anticodon. GO:0008033 The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.699
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MTPQPLADNLSPPDPARLAQSIKDWGRELGFQQVGISDVELGEHEAHLQRWLEAGYHGEMDYMAAHGSKRSRPAELVPGTLRVISLRMDYLPGDTRMAQVLATPEKAYVSRYALGRDYHKLIRKRLQQLAERIQAEVGPFGFRAFVDSAPVLEKAIAEQAGLGWIGKNTLVLNRKAGSYFFLGELFVDMPLPVDPAMDSEHCGRCSACLDICPTAAFVGPYRLDARRCISYLTIEYKGAIPLELRPLIGNRVFGCDDCQIVCPWNRFARPTGQGDFQPRHSLDNAELAELFLWSEEEFLGRTEGSPLRRAGYERWLRNLAVGLGNAPSTIPVLEALKARRGFPSELVREHVEWALRRHGET

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0052693 Catalysis of the reaction: epoxyqueuosine in tRNA + reductant = queuosine in tRNA + oxidised reductant.
  • GO:0046872 Binding to a metal ion.
  • GO:0008616 The chemical reactions and pathways resulting in the formation of queuosines, a series of nucleosides found in position 34 of tRNA and having an additional pentenyl ring added via an NH group to the methyl group of 7-methylguanosine. The pentenyl ring may carry other substituents. The wobble nucleoside of the tRNA sequence (position 34) corresponds to the first position of the anticodon.
  • GO:0008033 The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
195 267 Gene3D G3DSA:3.30.70.20 -
193 222 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
193 222 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
14 356 PANTHER PTHR30002 EPOXYQUEUOSINE REDUCTASE
14 356 InterPro IPR004453 Epoxyqueuosine reductase QueG
15 324 Hamap MF_00916 Epoxyqueuosine reductase [queG].
15 324 InterPro IPR004453 Epoxyqueuosine reductase QueG
147 265 SUPERFAMILY SSF46548 alpha-helical ferredoxin
22 358 NCBIfam TIGR00276 tRNA epoxyqueuosine(34) reductase QueG
22 358 InterPro IPR004453 Epoxyqueuosine reductase QueG
202 213 ProSitePatterns PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.
202 213 InterPro IPR017900 4Fe-4S ferredoxin, iron-sulphur binding, conserved site
201 265 Pfam PF13484 4Fe-4S double cluster binding domain
197 267 FunFam G3DSA:3.30.70.20:FF:000017 Epoxyqueuosine reductase
70 148 Pfam PF08331 Epoxyqueuosine reductase QueG, DUF1730
70 148 InterPro IPR013542 Epoxyqueuosine reductase QueG, DUF1730

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4950
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.699