Protein profile

PA4963

hypothetical protein

Genome: NC_002516.2

Gene: PA4963 Structure source: AlphaFold UniProt Q9HUK2

Export view

Amino acids 236

Annotations 0

Features 14

PDB binders 0

Druggability 0.685

Overview

Basic information about this protein and its source genome.

Accession: PA4963
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4963
Status: annotated
Amino acids: 236
Structure source: AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.685

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSAWRVFACLSLVSLLGLTGCAVHPPAQLYQLDVGAAAVPKKDGGAAVLLGPVQLADYLKRDVMVQRQADGILSLSTDARWAGNLETNVSQQLLRQMSSELGSSRLALFPEKPGFTPQVQVMLTISRLDSGPKQPAVIEARWRLLDQKGDLKDSRVFHEEEQHQGSIGDQIRAQSDLLKRLAAQLAKDVKPIAVAAEAPPPATARKPVAKPKVKEEEGPKMPLVVPIRTDAEVYRF

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

14 records

Show feature table

Start	End	DB	Term	Name
1	22	SignalP_GRAM_NEGATIVE	SignalP-noTM	SignalP-noTM
1	5	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
22	236	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1	21	ProSiteProfiles	PS51257	Prokaryotic membrane lipoprotein lipid attachment site profile.
1	21	SignalP_EUK	SignalP-noTM	SignalP-noTM
17	21	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
30	186	Pfam	PF03886	ABC-type transport auxiliary lipoprotein component
30	186	InterPro	IPR005586	ABC-type transport auxiliary lipoprotein component
6	16	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
1	21	Phobius	SIGNAL_PEPTIDE	Signal peptide region
21	207	Gene3D	G3DSA:3.40.50.10610	-
1	22	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
196	217	MobiDBLite	mobidb-lite	consensus disorder prediction
28	189	SUPERFAMILY	SSF159594	XCC0632-like

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4963	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.685