Protein profile

PA5012

heptosyltransferase II

Genome: NC_002516.2

Gene: DT376_06350 GNQ48_04220 waaF CAZ10_01410 rfaF L4V69_34350 PAERUG_P19_London_7_VIM_2_05_10_03072 IPC1295_08020 PA5012 Structure source: AlphaFold UniProt G3XD35 UniProt O05196
Export view
Amino acids 345
Annotations 7
Features 17
PDB binders 1
Druggability 0.7

Overview

Basic information about this protein and its source genome.

Accession
PA5012
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
DT376_06350 GNQ48_04220 waaF CAZ10_01410 rfaF L4V69_34350 PAERUG_P19_London_7_VIM_2_05_10_03072 IPC1295_08020 PA5012
Status
annotated
Amino acids
345
Structure source
AlphaFold
EC
2.4.99.24
GO
GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. GO:0008713 Catalysis of the reaction: heptosyl-KDO2-lipid A + ADP-L-glycero-beta-D-manno-heptose = heptosyl2-KDO2-lipid A + ADP + H+. GO:0071968 Catalysis of the reaction: galactosyl-glucosyl3-heptosyl3-KDO2-lipid A-bisphosphate + ADP-L-glycero-beta-D-manno-heptose = lipid A-core + ADP + H+. GO:0009244 The chemical reactions and pathways resulting in the formation of the core region of bacterial lipopolysaccharides, which contains ten saccharide residues. GO:0016757 Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor). GO:0009103 The chemical reactions and pathways resulting in the formation of lipopolysaccharides, any of a group of related, structurally complex components of the outer membrane of Gram-negative bacteria.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.7
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MRILIVGPSWVGDMVMAQTLFQCLRQRHPECVIDVLAPEWSRPILERMPEVRQALSFPLGHGVMDVATRRRIGRGLRGQYEQAILLPNSLKSALVPWFAGIPKRTGWRGEMRYGLLNDIRKLDKQRYPLMIERFMALAFEPGVELPKPYPQPRLRIDDGSRQAALDKFALSLDRPVLALCPGAEFGEAKRWPAEHYAAVAEAKIRAGWQVWLFGSKNDHPGGEEIRQRLIPGLREESFNLAGETSLAEAIDLMSCAGAVVSNDSGLMHVAAALDRPLVGVYGSTSPQFTPPLADRVEIVRLGLECSPCFERTCRFGHYNCLRELPPGLVLQALERLVGDPAEVAG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0008713 Catalysis of the reaction: heptosyl-KDO2-lipid A + ADP-L-glycero-beta-D-manno-heptose = heptosyl2-KDO2-lipid A + ADP + H+.
  • GO:0071968 Catalysis of the reaction: galactosyl-glucosyl3-heptosyl3-KDO2-lipid A-bisphosphate + ADP-L-glycero-beta-D-manno-heptose = lipid A-core + ADP + H+.
  • GO:0009244 The chemical reactions and pathways resulting in the formation of the core region of bacterial lipopolysaccharides, which contains ten saccharide residues.
  • GO:0016757 Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
  • GO:0009103 The chemical reactions and pathways resulting in the formation of lipopolysaccharides, any of a group of related, structurally complex components of the outer membrane of Gram-negative bacteria.

Sequence Features

Domain/signature hits from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
158 338 Gene3D G3DSA:3.40.50.2000 Glycogen Phosphorylase B;
159 338 FunFam G3DSA:3.40.50.2000:FF:000023 ADP-heptose--LPS heptosyltransferase II
1 17 Phobius SIGNAL_PEPTIDE Signal peptide region
3 12 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 337 PANTHER PTHR30160 TETRAACYLDISACCHARIDE 4'-KINASE-RELATED
2 335 CDD cd03789 GT9_LPS_heptosyltransferase
2 335 InterPro IPR002201 Glycosyl transferase, family 9
13 17 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
18 345 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
69 318 Pfam PF01075 Glycosyltransferase family 9 (heptosyltransferase)
69 318 InterPro IPR002201 Glycosyl transferase, family 9
2 337 NCBIfam TIGR02195 lipopolysaccharide heptosyltransferase II
2 337 InterPro IPR011910 ADP-heptose--LPS heptosyltransferase 2
2 147 FunFam G3DSA:3.40.50.2000:FF:000022 ADP-heptose--LPS heptosyltransferase II
1 338 SUPERFAMILY SSF53756 UDP-Glycosyltransferase/glycogen phosphorylase
2 145 Gene3D G3DSA:3.40.50.2000 Glycogen Phosphorylase B;
1 2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA5012
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.7

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 51 via homologs
Structural ligands 1 0 loaded crystals
Bioactive compounds 0 50 ZINC candidates
Drug-like & clean 22 0 PAINS alerts
Best available ligand signal
AFH PDB via homolog 621.4 Da · LogP -3.58 · TPSA 311.7
AFH PDB via homolog ZINC12360002 ZINC candidate · Tanimoto 0.671 ZINC12360703 ZINC candidate · Tanimoto 0.671 ZINC12503599 ZINC candidate · Tanimoto 0.671

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AFH
2H1H
P24173 621.4 Da LogP -3.58 TPSA 311.7 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.