Protein profile

PA5108

hypothetical protein

Genome: NC_002516.2

Gene: PA5108 Structure source: AlphaFold UniProt Q9HU75

Export view

Amino acids 85

Annotations 1

Features 13

PDB binders 0

Druggability 0.755

Overview

Basic information about this protein and its source genome.

Accession: PA5108
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA5108
Status: annotated
Amino acids: 85
Structure source: AlphaFold

GO:0019867 The external membrane of Gram-negative bacteria or certain organelles such as mitochondria and chloroplasts; freely permeable to most ions and metabolites.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.755

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MASFRTLAVVAFCVVLAACSKINQENYSKLKAGMSKAEVEAILGKPTECSGALGMSSCTWGDEKAFISVQYAADKALLFSGQGLK

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

GO:0019867 The external membrane of Gram-negative bacteria or certain organelles such as mitochondria and chloroplasts; freely permeable to most ions and metabolites.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records

Show feature table

Start	End	DB	Term	Name
1	19	ProSiteProfiles	PS51257	Prokaryotic membrane lipoprotein lipid attachment site profile.
6	16	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
21	85	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1	17	SignalP_GRAM_NEGATIVE	SignalP-noTM	SignalP-noTM
1	5	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
1	19	SignalP_EUK	SignalP-noTM	SignalP-noTM
1	20	Phobius	SIGNAL_PEPTIDE	Signal peptide region
17	20	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
19	84	Gene3D	G3DSA:3.30.1450.10	-
19	84	InterPro	IPR037873	BamE-like
22	47	Pfam	PF04355	SmpA / OmlA family
22	47	InterPro	IPR007450	Lipoprotein SmpA/OmlA
1	17	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA5108	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.755