Protein profile

PA5127

rRNA methylase

Genome: NC_002516.2

Gene: trmL PA5127 Structure source: Experimental + AlphaFold UniProt Q9HU57
Amino acids 153
Annotations 12
Features 16
PDB binders 2
Druggability 0.742

Overview

Basic information about this protein and its source genome.

Accession
PA5127
Gene
trmL PA5127
Status
annotated
Amino acids
153
Structure source
Experimental + AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.742
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MFHVILFQPEIPPNTGNIIRLCANAGCSLHLIEPLGFELDDKRLRRAGLDYHEYASVRRYPYLQSCLEALGQPRLFAFTTKGSRAFHEVAYQRGDAFLFGPESRGLPEDVRNALPTDRRLRLPMREGCRSLNLSNTVAVTVYEAWRQLGFAMD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 11 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

11
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0042802 Binding to an identical protein or proteins.
  • GO:0003723 Binding to an RNA molecule or a portion thereof.
  • GO:0141102 Catalysis of the reaction: 5-carboxymethylaminomethyluridine34 in tRNA(Leu) + S-adenosyl-L-methionine = 5-carboxymethylaminomethyl-2'-O-methyluridine34 in tRNA(Leu) + H+ + S-adenosyl-L-homocysteine.
  • GO:0141098 Catalysis of the reaction: cytidine(34) in tRNA + S-adenosyl-L-methionine = 2'-O-methylcytidine(34) in tRNA + H+ + S-adenosyl-L-homocysteine.
  • GO:0002131 The process in which the ribose of cytidine at position 34 in the anticodon of a tRNA is post-transcriptionally methylated at the 2'-O position.
  • GO:0002132 The process in which the ribose of uridine at position 34 in the anticodon of a tRNA is post-transcriptionally methylated at the 2'-O position.
  • GO:0008173 Catalysis of the transfer of a methyl group from a donor to a nucleoside residue in an RNA molecule.
  • GO:0006396 Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.
  • GO:0001510 Posttranscriptional addition of a methyl group to either a nucleotide or 2'-O ribose in a polyribonucleotide. Usually uses S-adenosylmethionine as a cofactor.
  • GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
1 152 Gene3D G3DSA:3.40.1280.10 -
1 152 InterPro IPR029026 tRNA (guanine-N1-)-methyltransferase, N-terminal
1 153 PIRSF PIRSF029256 SpoU_TrmH
1 153 InterPro IPR016914 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL
2 142 Pfam PF00588 SpoU rRNA Methylase family
2 142 InterPro IPR001537 tRNA/rRNA methyltransferase, SpoU type
2 151 Hamap MF_01885 tRNA (cytidine(34)-2'-O)-methyltransferase [trmL].
2 151 InterPro IPR016914 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL
1 150 PANTHER PTHR42971 TRNA (CYTIDINE(34)-2'-O)-METHYLTRANSFERASE
1 150 InterPro IPR016914 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL
3 148 CDD cd18094 SpoU-like_TrmL
3 148 InterPro IPR016914 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL
1 153 FunFam G3DSA:3.40.1280.10:FF:000002 Peptidylprolyl isomerase
1 150 NCBIfam TIGR00185 tRNA (uridine(34)/cytosine(34)/5-carboxymethylaminomethyluridine(34)-2'-O)-methyltransferase TrmL
1 150 SUPERFAMILY SSF75217 alpha/beta knot
1 150 InterPro IPR029028 Alpha/beta knot methyltransferases

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

2 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 6QKV
X-ray 2.01 Å A,B
100.0% 1-153
Viewing
PDB 6QH8
X-ray 2.20 Å A,B,C,D
99.3% 1-152
Loaded
AlphaFold PA5127
AlphaFold full sequence Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.742

Pockets (P2RANK)

Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).

P2RANK Sticks Spheres Surfaces Score Probability Labels Zoom Positions
1 5.79 0.282

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ADN Q5SLL8 267.2 Da LogP -1.98 TPSA 139.5 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
MTA Q5SLL8 297.3 Da LogP -0.61 TPSA 119.3 ✓ Ro5 ✓ Clean CSC[C@@H]1[C@H]([C@H]([C@@H](O1)n2cnc3c2ncnc3N)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.