Overview
Basic information about this protein and its source genome.
- Accession
- PA5127
- Gene
- trmL PA5127
- Status
- annotated
- Amino acids
- 153
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MFHVILFQPEIPPNTGNIIRLCANAGCSLHLIEPLGFELDDKRLRRAGLDYHEYASVRRYPYLQSCLEALGQPRLFAFTTKGSRAFHEVAYQRGDAFLFGPESRGLPEDVRNALPTDRRLRLPMREGCRSLNLSNTVAVTVYEAWRQLGFAMD
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
11- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0042802 Binding to an identical protein or proteins.
- GO:0003723 Binding to an RNA molecule or a portion thereof.
- GO:0141102 Catalysis of the reaction: 5-carboxymethylaminomethyluridine34 in tRNA(Leu) + S-adenosyl-L-methionine = 5-carboxymethylaminomethyl-2'-O-methyluridine34 in tRNA(Leu) + H+ + S-adenosyl-L-homocysteine.
- GO:0141098 Catalysis of the reaction: cytidine(34) in tRNA + S-adenosyl-L-methionine = 2'-O-methylcytidine(34) in tRNA + H+ + S-adenosyl-L-homocysteine.
- GO:0002131 The process in which the ribose of cytidine at position 34 in the anticodon of a tRNA is post-transcriptionally methylated at the 2'-O position.
- GO:0002132 The process in which the ribose of uridine at position 34 in the anticodon of a tRNA is post-transcriptionally methylated at the 2'-O position.
- GO:0008173 Catalysis of the transfer of a methyl group from a donor to a nucleoside residue in an RNA molecule.
- GO:0006396 Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.
- GO:0001510 Posttranscriptional addition of a methyl group to either a nucleotide or 2'-O ribose in a polyribonucleotide. Usually uses S-adenosylmethionine as a cofactor.
- GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 152 | Gene3D | G3DSA:3.40.1280.10 | - |
| 1 | 152 | InterPro | IPR029026 | tRNA (guanine-N1-)-methyltransferase, N-terminal |
| 1 | 153 | PIRSF | PIRSF029256 | SpoU_TrmH |
| 1 | 153 | InterPro | IPR016914 | tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL |
| 2 | 142 | Pfam | PF00588 | SpoU rRNA Methylase family |
| 2 | 142 | InterPro | IPR001537 | tRNA/rRNA methyltransferase, SpoU type |
| 2 | 151 | Hamap | MF_01885 | tRNA (cytidine(34)-2'-O)-methyltransferase [trmL]. |
| 2 | 151 | InterPro | IPR016914 | tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL |
| 1 | 150 | PANTHER | PTHR42971 | TRNA (CYTIDINE(34)-2'-O)-METHYLTRANSFERASE |
| 1 | 150 | InterPro | IPR016914 | tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL |
| 3 | 148 | CDD | cd18094 | SpoU-like_TrmL |
| 3 | 148 | InterPro | IPR016914 | tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL |
| 1 | 153 | FunFam | G3DSA:3.40.1280.10:FF:000002 | Peptidylprolyl isomerase |
| 1 | 150 | NCBIfam | TIGR00185 | tRNA (uridine(34)/cytosine(34)/5-carboxymethylaminomethyluridine(34)-2'-O)-methyltransferase TrmL |
| 1 | 150 | SUPERFAMILY | SSF75217 | alpha/beta knot |
| 1 | 150 | InterPro | IPR029028 | Alpha/beta knot methyltransferases |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
2 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.742 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 5.79 | 0.282 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.705 | ||||||
| 2 | 0.533 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100349915 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@H](O)[C@@H…
|
| ZINC105279440 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@H]1O[C@H](n2cnc3c(N)ncnc32)[C@H](O)[C@H]1O
|
| ZINC12501834 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@@…
|
| ZINC1318753 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@H](O)[C@H]…
|
| ZINC25963247 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@H]1O[C@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@H]…
|
| ZINC3830178 | 1.000 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@H]1O
|
| ZINC3869319 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@H…
|
| ZINC4228245 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C@@H…
|
| ZINC5929300 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C@H]…
|
| ZINC895091 | 1.000 | 297.3 Da LogP -0.61 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CSC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@H…
|
| ZINC253500647 | 0.766 | 298.3 Da LogP -0.49 TPSA 113.5 | ✓ Ro5 | ✓ Clean |
CSC[C@@H]1O[C@H](n2cnc3c(O)ncnc32)[C@H](O)[C@H]…
|
| ZINC5139067 | 0.756 | 283.3 Da LogP -1.04 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CS)[C@@H](O)[C@H]1O
|
| ZINC14766197 | 0.745 | 339.4 Da LogP 0.42 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(C)CSC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@@H](O…
|
| ZINC201682330 | 0.745 | 339.4 Da LogP 0.42 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(C)CSC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@H](O)…
|
| ZINC248157271 | 0.745 | 339.4 Da LogP 0.42 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(C)CSC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@H](O)…
|
| ZINC2516140 | 0.745 | 339.4 Da LogP 0.42 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(C)CSC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@@H](O…
|
| ZINC5138266 | 0.745 | 339.4 Da LogP 0.42 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(C)CSC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)…
|
| ZINC2047403 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@@H]1O
|
| ZINC2047673 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@H](O)[C@@H]1O
|
| ZINC2169830 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O
|
| ZINC3201876 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO)[C@@H](O)[C@@H]1O
|
| ZINC3201878 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H]…
|
| ZINC3814316 | 0.739 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C@@H]…
|
| ZINC3830179 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@H]1O
|
| ZINC3978047 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O
|
| ZINC3978048 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO)[C@H](O)[C@H]1O
|
| ZINC3978049 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@H]1O
|
| ZINC4048240 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO)[C@@H](O)[C@H]1O
|
| ZINC4773848 | 0.739 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@H](O)[C@@H]…
|
| ZINC4773849 | 0.739 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C@@H…
|
| ZINC4773850 | 0.739 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@@H…
|
| ZINC4773851 | 0.739 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@@…
|
| ZINC77981211 | 0.739 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@H]…
|
| ZINC82228511 | 0.739 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C@H]1O
|
| ZINC8580514 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@@H]1O
|
| ZINC895113 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O
|
| ZINC896706 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](O)[C@H]1O
|
| ZINC970363 | 0.739 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O
|
| ZINC1081541 | 0.723 | 285.7 Da LogP -0.73 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CCl)[C@@H](O)[C@@H]…
|
| ZINC4188096 | 0.723 | 297.3 Da LogP -2.62 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@@H](…
|
| ZINC4188103 | 0.723 | 297.3 Da LogP -2.62 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H]…
|
| ZINC4188112 | 0.723 | 297.3 Da LogP -2.62 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@@H](…
|
| ZINC4188116 | 0.723 | 297.3 Da LogP -2.62 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H]…
|
| ZINC5941240 | 0.723 | 269.2 Da LogP -1.00 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CF)[C@@H](O)[C@H]1O
|
| ZINC5163039 | 0.712 | 340.4 Da LogP -0.89 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NCCCSC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C…
|
| ZINC73315766 | 0.704 | 381.5 Da LogP 1.73 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCSC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](…
|
| ZINC73315769 | 0.704 | 381.5 Da LogP 1.73 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCSC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H]…
|
| ZINC73315770 | 0.704 | 381.5 Da LogP 1.73 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCSC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](…
|
| ZINC73315774 | 0.704 | 381.5 Da LogP 1.73 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCSC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H]…
|
| ZINC13522378 | 0.698 | 370.4 Da LogP -1.83 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSC[C@H](N)C(=O)O)[…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.