Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA5128
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA5128 secB
Status: annotated
Amino acids: 163
Structure source: AlphaFold

GO

GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. GO:0070678 Binding to a preprotein, the unprocessed form of a protein destined to undergo co- or post-translational processing. GO:0051082 Binding to an unfolded protein. GO:0036506 Maintaining a protein in an unfolded, soluble state. GO:0006457 The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure. GO:0051262 The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.75

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MTEQATNGAADEQQPQFSLQRIYLRDLSFESPKSPEIFRQEWNPSISLDLNTRQKQLDGDFYEVVLTVSVTVKNGEDTTAFIAEVQQAGIFLIKNLDPSSMSHTLGAFCPNILFPYAREALDNLVVRGSFPALMLSPVNFDALYAQEIARMQASGEIPTPSVQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

8 GO

Gene Ontology (GO)

8

GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
GO:0070678 Binding to a preprotein, the unprocessed form of a protein destined to undergo co- or post-translational processing.
GO:0051082 Binding to an unfolded protein.
GO:0036506 Maintaining a protein in an unfolded, soluble state.
GO:0006457 The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
GO:0051262 The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
GO:0043952 The process in which unfolded proteins are transported across the cytoplasmic membrane in Gram-positive and Gram-negative bacteria by the Sec complex, in a process involving proteolytic cleavage of an N-terminal signal peptide.
GO:0015031 The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records

Show feature table

Start	End	DB	Term	Name
11	150	Pfam	PF02556	Preprotein translocase subunit SecB
11	150	InterPro	IPR003708	Bacterial protein export chaperone SecB
8	148	SUPERFAMILY	SSF54611	SecB-like
8	148	InterPro	IPR035958	SecB-like superfamily
1	157	PANTHER	PTHR36918	-
1	157	InterPro	IPR003708	Bacterial protein export chaperone SecB
11	147	NCBIfam	TIGR00809	protein-export chaperone SecB
11	147	InterPro	IPR003708	Bacterial protein export chaperone SecB
1	152	Hamap	MF_00821	Protein-export protein SecB [secB].
1	152	InterPro	IPR003708	Bacterial protein export chaperone SecB
2	157	Gene3D	G3DSA:3.10.420.10	-
2	157	InterPro	IPR035958	SecB-like superfamily
80	100	PRINTS	PR01594	Bacterial protein-transport SecB chaperone protein signature
80	100	InterPro	IPR003708	Bacterial protein export chaperone SecB
19	36	PRINTS	PR01594	Bacterial protein-transport SecB chaperone protein signature
19	36	InterPro	IPR003708	Bacterial protein export chaperone SecB
130	148	PRINTS	PR01594	Bacterial protein-transport SecB chaperone protein signature
130	148	InterPro	IPR003708	Bacterial protein export chaperone SecB
104	126	PRINTS	PR01594	Bacterial protein-transport SecB chaperone protein signature
104	126	InterPro	IPR003708	Bacterial protein export chaperone SecB

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA5128	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.75
3				0.357
2				0.282

PA5128