Protein profile

PA5129

glutaredoxin

Genome: NC_002516.2

Gene: grx PA5129 Structure source: AlphaFold UniProt Q9HU55
Amino acids 84
Annotations 4
Features 20
PDB binders 3
Druggability 0.724

Overview

Basic information about this protein and its source genome.

Accession
PA5129
Gene
grx PA5129
Status
annotated
Amino acids
84
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
35.802
Human E-value
2.66e-11
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.724
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MPPVVIYTTAWCPYCIRAKQLLQRKGVDFQEIACDGKPELRAELARKAGSTTVPQIWIGETHVGGCDDLHALERAGKLDALLSA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0015038 Catalysis of the reaction: 2 glutathione + electron acceptor = glutathione disulfide + electron donor.
  • GO:0045454 Any process that maintains the redox environment of a cell or compartment within a cell.
  • GO:0034599 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
6 22 ProSitePatterns PS00195 Glutaredoxin active site.
6 22 InterPro IPR011767 Glutaredoxin active site
3 76 CDD cd03418 GRX_GRXb_1_3_like
3 76 InterPro IPR011900 Glutaredoxin, GrxC
4 82 NCBIfam TIGR02181 glutaredoxin 3
4 82 InterPro IPR011900 Glutaredoxin, GrxC
1 84 ProSiteProfiles PS51354 Glutaredoxin domain profile.
1 83 FunFam G3DSA:3.40.30.10:FF:000018 Glutaredoxin
46 59 PRINTS PR00160 Glutaredoxin signature
46 59 InterPro IPR014025 Glutaredoxin subgroup
4 22 PRINTS PR00160 Glutaredoxin signature
4 22 InterPro IPR014025 Glutaredoxin subgroup
60 73 PRINTS PR00160 Glutaredoxin signature
60 73 InterPro IPR014025 Glutaredoxin subgroup
3 83 PANTHER PTHR45694 GLUTAREDOXIN 2
1 83 SUPERFAMILY SSF52833 Thioredoxin-like
1 83 InterPro IPR036249 Thioredoxin-like superfamily
4 63 Pfam PF00462 Glutaredoxin
4 63 InterPro IPR002109 Glutaredoxin
1 84 Gene3D G3DSA:3.40.30.10 Glutaredoxin

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA5129
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.724
3 0.31

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
FES Q5PSJ1 175.8 Da LogP 1.29 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]S[Fe]1
GDS A8MJH2 612.6 Da LogP -3.88 TPSA 317.6 3 viol. ✓ Clean C(CC(=O)N[C@@H](CSSC[C@@H](C(=O)NCC(=O)O)NC(=O)…
GSH A0A1W6I4R7 307.3 Da LogP -2.21 TPSA 158.8 1 viol. ✓ Clean C(CC(=O)N[C@@H](CS)C(=O)NCC(=O)O)[C@@H](C(=O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.