Overview
Basic information about this protein and its source genome.
- Accession
- PA5148
- Gene
- PA5148
- Status
- annotated
- Amino acids
- 90
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSRTVMCRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQTMLINERRLNMMNAEDRKFLQQEMDKFLSGEDYAKADGYVPPSA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0005506 Binding to an iron (Fe) ion.
- GO:0034599 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 89 | SUPERFAMILY | SSF111148 | YggX-like |
| 1 | 89 | InterPro | IPR036766 | Fe(II) trafficking protein YggX superfamily |
| 1 | 88 | Hamap | MF_00686 | Probable Fe(2+)-trafficking protein [yggX]. |
| 1 | 88 | InterPro | IPR007457 | Fe(II) trafficking protein YggX |
| 1 | 89 | PANTHER | PTHR36965 | FE(2+)-TRAFFICKING PROTEIN-RELATED |
| 1 | 89 | InterPro | IPR007457 | Fe(II) trafficking protein YggX |
| 1 | 90 | FunFam | G3DSA:1.10.3880.10:FF:000001 | Probable Fe(2+)-trafficking protein |
| 1 | 88 | Pfam | PF04362 | Bacterial Fe(2+) trafficking |
| 1 | 90 | PIRSF | PIRSF029827 | Fe_traffic_YggX |
| 1 | 90 | InterPro | IPR007457 | Fe(II) trafficking protein YggX |
| 1 | 90 | Gene3D | G3DSA:1.10.3880.10 | Fe(II) trafficking protein YggX |
| 1 | 90 | InterPro | IPR036766 | Fe(II) trafficking protein YggX superfamily |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
1 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 0.67 | 0.001 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.674 |