Protein profile

PA5152

ABC transporter ATP-binding protein

Genome: NC_002516.2

Gene: PA5152 Structure source: AlphaFold UniProt Q9HU32
Amino acids 257
Annotations 6
Features 17
PDB binders 6
Druggability 0.681

Overview

Basic information about this protein and its source genome.

Accession
PA5152
Gene
PA5152
Status
annotated
Amino acids
257
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
58.333
Human E-value
7.32e-06
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.681
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MAEATPALEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQILVSGEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRRVLGKSKAEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVFENPQSARCKQFMSSHR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0015424 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + amino acid(out/in) = ADP + phosphate + amino acid(in/out).
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
  • GO:0042626 Primary active transporter of a solute across a membrane, via the reaction: ATP + H2O = ADP + phosphate, to directly drive the transport of a substance across a membrane. The transport protein may be transiently phosphorylated (P-type transporters), or not (ABC-type transporters and other families of transporters). Primary active transport occurs up the solute's concentration gradient and is driven by a primary energy source.
  • GO:0003333 The process in which an amino acid is transported across a membrane.

Sequence Features

Domain/signature hits from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
32 230 SMART SM00382 AAA_5
8 229 CDD cd03262 ABC_HisP_GlnQ
154 168 ProSitePatterns PS00211 ABC transporters family signature.
154 168 InterPro IPR017871 ABC transporter-like, conserved site
6 257 FunFam G3DSA:3.40.50.300:FF:000020 Amino acid ABC transporter ATP-binding component
23 182 Pfam PF00005 ABC transporter
23 182 InterPro IPR003439 ABC transporter-like, ATP-binding domain
4 257 PIRSF PIRSF039085 ABC_ATPase_HisP
4 257 InterPro IPR030679 ABC-type amino acid transport system, ATPase component, HisP-type
4 257 Gene3D G3DSA:3.40.50.300 -
4 257 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
32 230 InterPro IPR003593 AAA+ ATPase domain
8 252 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
8 252 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
3 254 PANTHER PTHR43166 AMINO ACID IMPORT ATP-BINDING PROTEIN
8 253 ProSiteProfiles PS50893 ATP-binding cassette, ABC transporter-type domain profile.
8 253 InterPro IPR003439 ABC transporter-like, ATP-binding domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA5152
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.681

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

56 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2BA Q9KIF7 658.4 Da LogP -1.63 TPSA 309.7 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@H]4[C@H](O3)C…
AGS D0VWX4 523.2 Da LogP -1.51 TPSA 262.1 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ANP D0VWX4 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AT4 A0A0D8G707 443.3 Da LogP -0.81 TPSA 212.4 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
BET Q9KIF7 118.2 Da LogP -0.22 TPSA 37.3 ✓ Ro5 ✓ Clean C[N+](C)(C)CC(=O)O
POP O57933 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.