Overview
Basic information about this protein and its source genome.
- Accession
- PA5192
- Gene
- pckA PA5192
- Status
- annotated
- Amino acids
- 513
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTQANNAVYTDISAAQLVEEAIRRGEGELAANGSLVVRTGHRTGRSPVDRFIVEEPSTKDAIAWGNINRPFPADKFDALWARVEAFNNAQDHFVSHVHVGSAEAYYLPVKMTTATAWQNLFGRCLFIEPEQYNPAGKDEWQVLNVANFECVPERDGTNSDGCVILNFAQKKVLIAGMRYAGEMKKAMFSVQNFLLPERDVLPMHCAANIGEAGDVTLFFGLSGTGKTTLSADESRYLIGDDEHGWGEGVVFNVEGGCYAKCIDLSEKNEPVIWKAIKFGAVLENVVLDEERVPNYADDSLTQNSRAAYPLEHVEKRSEKNLGGEPNAVIFLTCDLTGVLPPVSILNNEQAAYHFLSGYTALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGVYAELLIKRIKAFGSKVYLVNTGWTGGGYGVGKRFNIPTTRGVIAAIQSGALIGAETEHLEIINLDVPKAVPGVETNLLNPRNTWADKAAYDEAAKGLAKQFIENFKKFEVSDAIKAAGPQL
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
7- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0046872 Binding to a metal ion.
- GO:0004612 Catalysis of the reaction: ATP + oxaloacetate = ADP + CO2 + H+ + phosphoenolpyruvate.
- GO:0006094 The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
- GO:0004611 Catalysis of the reaction: phosphate + oxaloacetate = phosphoenolpyruvate + CO2 + other reaction products.
- GO:0017076 Binding to a purine nucleotide, a compound consisting of a purine nucleoside esterified with (ortho)phosphate.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 7 | 467 | Pfam | PF01293 | Phosphoenolpyruvate carboxykinase |
| 7 | 467 | InterPro | IPR001272 | Phosphoenolpyruvate carboxykinase, ATP-utilising |
| 26 | 317 | Gene3D | G3DSA:2.170.8.10 | Phosphoenolpyruvate Carboxykinase, domain 2 |
| 1 | 513 | Hamap | MF_00453 | Phosphoenolpyruvate carboxykinase (ATP) [pckA]. |
| 1 | 513 | InterPro | IPR001272 | Phosphoenolpyruvate carboxykinase, ATP-utilising |
| 203 | 502 | Gene3D | G3DSA:3.90.228.20 | - |
| 203 | 502 | InterPro | IPR013035 | Phosphoenolpyruvate carboxykinase, C-terminal |
| 1 | 513 | PIRSF | PIRSF006294 | PEP_crbxkin |
| 237 | 252 | ProSitePatterns | PS00532 | Phosphoenolpyruvate carboxykinase (ATP) signature. |
| 237 | 252 | InterPro | IPR015994 | Phosphoenolpyruvate carboxykinase (ATP), conserved site |
| 6 | 510 | CDD | cd00484 | PEPCK_ATP |
| 6 | 510 | InterPro | IPR001272 | Phosphoenolpyruvate carboxykinase, ATP-utilising |
| 7 | 513 | NCBIfam | TIGR00224 | phosphoenolpyruvate carboxykinase (ATP) |
| 7 | 513 | InterPro | IPR001272 | Phosphoenolpyruvate carboxykinase, ATP-utilising |
| 5 | 202 | Gene3D | G3DSA:3.40.449.10 | Phosphoenolpyruvate Carboxykinase, domain 1 |
| 5 | 202 | InterPro | IPR008210 | Phosphoenolpyruvate carboxykinase, N-terminal |
| 6 | 512 | PANTHER | PTHR30031 | PHOSPHOENOLPYRUVATE CARBOXYKINASE ATP |
| 6 | 512 | InterPro | IPR001272 | Phosphoenolpyruvate carboxykinase, ATP-utilising |
| 200 | 513 | SUPERFAMILY | SSF53795 | PEP carboxykinase-like |
| 5 | 199 | SUPERFAMILY | SSF68923 | PEP carboxykinase N-terminal domain |
| 5 | 199 | InterPro | IPR008210 | Phosphoenolpyruvate carboxykinase, N-terminal |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA5192
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 14 | 0.729 | ||||||
| 16 | 0.245 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 03S | P22259 | 96.1 Da LogP -0.50 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)O
|
|
| AF3 | P22259 | 84.0 Da LogP 0.88 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
F[Al](F)F
|
|
| BTB | P22259 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
C(CO)N(CCO)C(CO)(CO)CO
|
|
| CO2 | P22259 | 44.0 Da LogP -0.58 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C(=O)=O
|
|
| DT3 | A6VKV4 | 201.2 Da LogP -1.82 TPSA 97.7 | ✓ Ro5 | ✓ Clean |
C([C@H]([C@@H](CS(=O)(=O)[O-])O)O)S
|
|
| OAA | P22259 | 131.1 Da LogP -2.22 TPSA 94.5 | ✓ Ro5 | ✓ Clean |
C(C(=O)C(=O)O)C(=O)[O-]
|
|
| OXD | O09460 | 90.0 Da LogP -0.84 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(=O)(C(=O)O)O
|
|
| OXL | P22259 | 88.0 Da LogP -3.51 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(=O)(C(=O)[O-])[O-]
|
|
| PYR | A6VKV4 | 88.1 Da LogP -0.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CC(=O)C(=O)O
|
|
| THJ | P22259 | 112.1 Da LogP -1.01 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
[O-]S(=O)(=O)[S-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1615342 | 1.000 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
OCCN(CCO)C(CO)(CO)CO
|
| ZINC2334905 | 0.522 | 261.4 Da LogP 1.10 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CC(C)CCN(CCC(C)C)C(CO)(CO)CO
|
| ZINC3159953 | 0.522 | 261.4 Da LogP 1.38 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCN(CCCCC)C(CO)(CO)CO
|
| ZINC5297554 | 0.500 | 289.5 Da LogP 2.16 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCCN(CCCCCC)C(CO)(CO)CO
|
| ZINC97941822 | 0.500 | 317.5 Da LogP 2.94 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCN(CCCCCCC)C(CO)(CO)CO
|
| ZINC97942927 | 0.500 | 373.6 Da LogP 4.51 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCN(CCCCCCCCC)C(CO)(CO)CO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.