Protein profile

PA5277

diaminopimelate decarboxylase

Genome: NC_002516.2

Gene: PA5277 lysA Structure source: AlphaFold UniProt P19572
Amino acids 415
Annotations 5
Features 41
PDB binders 11
Druggability 0.668

Overview

Basic information about this protein and its source genome.

Accession
PA5277
Gene
PA5277 lysA
Status
annotated
Amino acids
415
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
31.646
Human E-value
4.39e-06
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.668
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MDTFSYRDAELFAEGVALSRIAERFGTPTYVYSRAHIEAQYRAYADALAGMPHLVCFAVKANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGDPAKVVFSGVGKTRDDMRRALEVGVHCFNVESGEELERLQRVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIDEAEAVYARAAELDHLEVIGVDCHIGSQLTQLEPFLDALERLLGLVDRLAGKGIGIRHLDLGGGLGVRYRDEQPPLAGDYIRAIRERLHGRDLTLVFEPGRSIVANAGVLLTRVEYLKHTEHKDFAIVDAAMNDLIRPALYQAWMDVQAVRPRDAAPRRYDLVGPICETGDFLAKDRDLALAEGDLLAVRSAGAYGFVMSSNYNTRGRAAEVLVDGEQTHEVRRRETVQELYAGESLLPQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0008836 Catalysis of the reaction: meso-2,6-diaminopimelate + H+ = L-lysine + CO2.
  • GO:0030170 Binding to pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
  • GO:0009089 OBSOLETE. The chemical reactions and pathways resulting in the formation of lysine, via the intermediate diaminopimelate.
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.

Sequence Features

Domain/signature hits from InterPro and related databases.

41 records
Show feature table
Start End DB Term Name
16 407 Gene3D G3DSA:2.40.37.10 Lyase, Ornithine Decarboxylase; Chain A, domain 1
16 407 InterPro IPR009006 Alanine racemase/group IV decarboxylase, C-terminal
34 277 FunFam G3DSA:3.20.20.10:FF:000003 Diaminopimelate decarboxylase
15 411 Hamap MF_02120 Diaminopimelate decarboxylase [lysA].
15 411 InterPro IPR002986 Diaminopimelate decarboxylase, LysA
281 368 Pfam PF00278 Pyridoxal-dependent decarboxylase, C-terminal sheet domain
281 368 InterPro IPR022643 Orn/DAP/Arg decarboxylase 2, C-terminal
268 407 FunFam G3DSA:2.40.37.10:FF:000003 Diaminopimelate decarboxylase
26 282 SUPERFAMILY SSF51419 PLP-binding barrel
26 282 InterPro IPR029066 PLP-binding barrel
35 280 Pfam PF02784 Pyridoxal-dependent decarboxylase, pyridoxal binding domain
35 280 InterPro IPR022644 Orn/DAP/Arg decarboxylase 2, N-terminal
57 75 ProSitePatterns PS00878 Orn/DAP/Arg decarboxylases family 2 pyridoxal-P attachment site.
57 75 InterPro IPR022653 Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site
164 173 PRINTS PR01181 Diaminopimelate decarboxylase signature
164 173 InterPro IPR002986 Diaminopimelate decarboxylase, LysA
298 316 PRINTS PR01181 Diaminopimelate decarboxylase signature
298 316 InterPro IPR002986 Diaminopimelate decarboxylase, LysA
75 92 PRINTS PR01181 Diaminopimelate decarboxylase signature
75 92 InterPro IPR002986 Diaminopimelate decarboxylase, LysA
378 400 PRINTS PR01181 Diaminopimelate decarboxylase signature
378 400 InterPro IPR002986 Diaminopimelate decarboxylase, LysA
255 411 SUPERFAMILY SSF50621 Alanine racemase C-terminal domain-like
255 411 InterPro IPR009006 Alanine racemase/group IV decarboxylase, C-terminal
25 389 CDD cd06828 PLPDE_III_DapDC
25 389 InterPro IPR002986 Diaminopimelate decarboxylase, LysA
34 277 Gene3D G3DSA:3.20.20.10 Alanine racemase
34 277 InterPro IPR029066 PLP-binding barrel
6 410 NCBIfam TIGR01048 diaminopimelate decarboxylase
6 410 InterPro IPR002986 Diaminopimelate decarboxylase, LysA
57 75 PRINTS PR01179 Ornithine/diaminopimelate/arginine (ODA) decarboxylase family signature
57 75 InterPro IPR000183 Ornithine/DAP/Arg decarboxylase
368 381 PRINTS PR01179 Ornithine/diaminopimelate/arginine (ODA) decarboxylase family signature
368 381 InterPro IPR000183 Ornithine/DAP/Arg decarboxylase
190 203 PRINTS PR01179 Ornithine/diaminopimelate/arginine (ODA) decarboxylase family signature
190 203 InterPro IPR000183 Ornithine/DAP/Arg decarboxylase
270 289 PRINTS PR01179 Ornithine/diaminopimelate/arginine (ODA) decarboxylase family signature
270 289 InterPro IPR000183 Ornithine/DAP/Arg decarboxylase
77 89 PRINTS PR01179 Ornithine/diaminopimelate/arginine (ODA) decarboxylase family signature
77 89 InterPro IPR000183 Ornithine/DAP/Arg decarboxylase
6 407 PANTHER PTHR43727 DIAMINOPIMELATE DECARBOXYLASE

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA5277
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
7 0.668
3 0.509
5 0.378

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

61 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AZ1 Q58497 188.2 Da LogP 1.89 TPSA 74.6 ✓ Ro5 ✓ Clean C(CCCC(=O)O)CCCC(=O)O
DMO P07805 182.2 Da LogP -0.23 TPSA 89.3 ✓ Ro5 ✓ Clean C(CC(C(F)F)(C(=O)O)N)CN
DN9 A0A0H3JPF2 465.4 Da LogP -1.41 TPSA 235.8 1 viol. ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)CNCCNC(=O)C[C@](CC(=O)…
GET Q9TZZ6 496.6 Da LogP -5.61 TPSA 248.4 2 viol. ✓ Clean C[C@H]([C@@H]1[C@H]([C@@H]([C@H]([C@H](O1)O[C@@…
LLP A1SR00 375.3 Da LogP 0.71 TPSA 175.6 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)/C=N/CCCCC(C(=O)O)N)O
ORX P07805 363.3 Da LogP -0.01 TPSA 175.2 1 viol. ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)CN[C@H](CCCN)C(=O)O)O
PLG P07805 306.2 Da LogP -0.12 TPSA 149.2 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)CNCC(=O)O)O
PUT P07805 88.2 Da LogP -0.32 TPSA 52.0 ✓ Ro5 ✓ Clean C(CCN)CN
PXP P07805 249.2 Da LogP 0.20 TPSA 120.1 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)CO)O
TME A1SR00 44.1 Da LogP 1.42 TPSA 0.0 ✓ Ro5 ✓ Clean CCC
X3J A0A0H3JPF2 234.2 Da LogP -2.26 TPSA 150.0 ✓ Ro5 ✓ Clean C(CNC(=O)C[C@](CC(=O)O)(C(=O)O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.