Protein profile

PA5335

hypothetical protein

Genome: NC_002516.2

Gene: PA5335 Structure source: AlphaFold UniProt Q9HTM3

Export view

Amino acids 287

Annotations 2

Features 8

PDB binders 0

Druggability 0.663

Overview

Basic information about this protein and its source genome.

Accession: PA5335
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA5335
Status: annotated
Amino acids: 287
Structure source: AlphaFold

GO:0016891 Catalysis of the hydrolysis of ester linkages within ribonucleic acids by creating internal breaks to yield 5'-phosphomonoesters. GO:0006401 The chemical reactions and pathways resulting in the breakdown of RNA, ribonucleic acid, one of the two main type of nucleic acid, consisting of a long, unbranched macromolecule formed from ribonucleotides joined in 3',5'-phosphodiester linkage.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.663

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MVHSMTAFARVEQAGTHGTLSWELRSVNHRYLEPHLRLPDAFRDLEGAVREALRQGLSRGKVECTLRFAEETAGKSLQVDQERARQLVAAAEGVAALIRQPAPLDPLAVLAWPGVLVADSADPQALNAAALEAFGQALEQLKAGRSREGLELAKLLNDRLDAMLVEVGNLRELVPTMLANQRQKILDRFAELKAELDPQRLEQELVLLAQKSDVAEELDRLATHVGEVRRVLKAGGAAGRRLDFLMQELNREANTLGSKAFDPRSTQAAVNLKVLIEQMREQVQNIE

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

GO:0016891 Catalysis of the hydrolysis of ester linkages within ribonucleic acids by creating internal breaks to yield 5'-phosphomonoesters.
GO:0006401 The chemical reactions and pathways resulting in the breakdown of RNA, ribonucleic acid, one of the two main type of nucleic acid, consisting of a long, unbranched macromolecule formed from ribonucleotides joined in 3',5'-phosphodiester linkage.

Sequence Features

Domain/signature hits from InterPro and related databases.

8 records

Show feature table

Start	End	DB	Term	Name
269	287	Coils	Coil	Coil
203	287	Pfam	PF08340	Domain of unknown function (DUF1732)
203	287	InterPro	IPR013551	Domain of unknown function DUF1732
2	153	Pfam	PF03755	YicC-like family, N-terminal region
2	153	InterPro	IPR013527	YicC-like, N-terminal
1	287	PANTHER	PTHR30636	UNCHARACTERIZED
1	287	InterPro	IPR005229	UPF0701 protein YicC-like
1	287	NCBIfam	TIGR00255	YicC family protein

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA5335	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.663