Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA5374
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA5374 betI
Status: annotated
Amino acids: 197
Structure source: AlphaFold

GO

GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon. GO:0019285 The chemical reactions and pathways resulting in the formation of betaine (N-trimethylglycine) from the oxidation of choline. GO:0045892 Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.746

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MPKVGMQPIRRSQLIHATLEAVDQVGMGDASIALIARLAGVSNGIISHYFQDKNGLLEATMRHLLSALSKAVRERRAALYDDSPRAHLRAIVEGNFDDSQVNGPAMKTWLAFWATSMHQPALRRLQRVNDHRLYSNLCYQFRRQLSADDARAAARGLAALIDGLWLRGALTGDAFDTDEALNIAYDYLDQQLAKQSG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6

GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
GO:0019285 The chemical reactions and pathways resulting in the formation of betaine (N-trimethylglycine) from the oxidation of choline.
GO:0045892 Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records

Show feature table

Start	End	DB	Term	Name
1	197	Hamap	MF_00768	HTH-type transcriptional regulator BetI [betI].
1	197	InterPro	IPR017757	Transcriptional repressor BetI
6	196	Gene3D	G3DSA:1.10.357.10	Tetracycline Repressor, domain 2
26	57	ProSitePatterns	PS01081	TetR-type HTH domain signature.
26	57	InterPro	IPR023772	DNA-binding HTH domain, TetR-type, conserved site
8	193	PANTHER	PTHR30055	HTH-TYPE TRANSCRIPTIONAL REGULATOR RUTR
2	192	NCBIfam	TIGR03384	transcriptional regulator BetI
2	192	InterPro	IPR017757	Transcriptional repressor BetI
81	193	SUPERFAMILY	SSF48498	Tetracyclin repressor-like, C-terminal domain
81	193	InterPro	IPR036271	Tetracyclin repressor-like, C-terminal domain superfamily
8	68	ProSiteProfiles	PS50977	TetR-type HTH domain profile.
8	68	InterPro	IPR001647	DNA-binding HTH domain, TetR-type
5	79	SUPERFAMILY	SSF46689	Homeodomain-like
5	79	InterPro	IPR009057	Homeobox-like domain superfamily
14	59	Pfam	PF00440	Bacterial regulatory proteins, tetR family
14	59	InterPro	IPR001647	DNA-binding HTH domain, TetR-type
84	192	Pfam	PF13977	BetI-type transcriptional repressor, C-terminal
84	192	InterPro	IPR039538	BetI-type transcriptional repressor, C-terminal

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA5374	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.746

PA5374