Overview
Basic information about this protein and its source genome.
- Accession
- PA5375
- Gene
- betT1 PA5375
- Status
- annotated
- Amino acids
- 516
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MFFGSTALILVLTAALILYPDSAGALLGRIQEWLSHSFGWYYMLAIGAYLFFVAWVAFSRFGTLKLGEEHEKPDFSYGAWAGMLFSSGIGISLLYFAASEPIDHLYHPPEGVPGSPQAARQALQLTFLHWGLHGWAIYALVGLAVGYFAYRHRQPLALRSALYPILGERWVKGAAGHAVDCFGIFVTLLGLVTNLGIGALQVSSGLEYLTGMPHSKGTLLAVILAMSLVATLAAVSGVEKGIRRLSNLNIVLFSSLLLFVLVCGSTLELLNGFVQNLGDYLDGLVLKTFDLYVYTGAGAGKSEEWLGLWTLFYWAWWISWAPFVGMFIARISRGRSVRELVCGVLLIPLGFTLAWLSVFGNSALDLVMNHGATDLGKAALEQPSMSIYLLLEHYPLSKIVIGLSIFVGFVLFLTPADSGSVMLANLSRSGGELDEDAPNWLRILWSAVVTLVTIGLLFAGNFTAMQTVVVLAGLPFSAVLILFMFGLHKAMRADYEAQVGDRRTYQPVPAPTQPQT
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
7- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0005275 Enables the transfer of amines, including polyamines, from one side of a membrane to the other. Amines are organic compounds that are weakly basic in character and contain an amino (-NH2) or substituted amino group.
- GO:0033265 Binding to choline, the amine 2-hydroxy-N,N,N-trimethylethanaminium.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0042426 The chemical reactions and pathways resulting in the breakdown of choline (2-hydroxyethyltrimethylammonium), an amino alcohol that occurs widely in living organisms as a constituent of certain types of phospholipids and in the neurotransmitter acetylcholine.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0071705 The directed movement of nitrogen-containing compounds into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 424 | 442 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 24 | 38 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 305 | 327 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 79 | 98 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 151 | 177 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 488 | 516 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 200 | 218 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 219 | 238 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 39 | 58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 340 | 359 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 239 | 249 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 463 | 467 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 468 | 487 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 132 | 150 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 59 | 78 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 1 | 24 | SignalP_EUK | SignalP-TM | SignalP-TM |
| 1 | 6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 399 | 423 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 250 | 274 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 99 | 131 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 399 | 421 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 360 | 398 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 127 | 149 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 19 | 23 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 2 | 493 | Pfam | PF02028 | BCCT, betaine/carnitine/choline family transporter |
| 2 | 493 | InterPro | IPR000060 | BCCT transporter family |
| 441 | 460 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 340 | 359 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 275 | 310 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 245 | 267 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 443 | 462 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 23 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 182 | 204 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 7 | 18 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 2 | 503 | PANTHER | PTHR30047 | HIGH-AFFINITY CHOLINE TRANSPORT PROTEIN-RELATED |
| 2 | 503 | InterPro | IPR000060 | BCCT transporter family |
| 2 | 20 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 465 | 487 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 75 | 97 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 178 | 199 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 311 | 328 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 329 | 339 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 219 | 238 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 40 | 62 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 39 | 494 | NCBIfam | TIGR00842 | BCCT family transporter |
| 39 | 494 | InterPro | IPR000060 | BCCT transporter family |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA5375
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.732 | ||||||
| 16 | 0.477 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 152 | P31553 | 162.2 Da LogP -0.47 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[N+](C)(C)C[C@@H](CC(=O)O)O
|
|
| 1Y8 | P54582 | 165.1 Da LogP 1.32 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
C[As](C)(C)CCO
|
|
| BET | P54582 | 118.2 Da LogP -0.22 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[N+](C)(C)CC(=O)O
|
|
| CHT | P54582 | 104.2 Da LogP -0.32 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
C[N+](C)(C)CCO
|
|
| CM5 | B4EY22 | 494.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
C1CCC(CC1)CCCCCO[C@H]2[C@@H]([C@H]([C@@H]([C@H]…
|
|
| FLC | P54582 | 189.1 Da LogP -5.25 TPSA 140.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
|
|
| NM2 | B4EY22 | 146.2 Da LogP 0.56 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[N+](C)(C)CCCC(=O)O
|
|
| PGT | P54582 | 751.0 Da LogP 10.67 TPSA 148.8 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)O[C@@H](COC(=O)CCCCCCCCCC…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC102191119 | 1.000 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@@H](O)CO…
|
| ZINC14881288 | 1.000 | 494.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
OC[C@H]1O[C@H](O[C@@H]2[C@@H](CO)O[C@@H](OCCCCC…
|
| ZINC58649551 | 1.000 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](O)CO)…
|
| ZINC58649445 | 0.818 | 452.5 Da LogP -2.40 TPSA 178.5 | 2 viol. | ✓ Clean |
OC[C@H]1O[C@H](O[C@@H]2[C@@H](CO)O[C@@H](OCCC3C…
|
| ZINC102191158 | 0.795 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[C@…
|
| ZINC14880758 | 0.795 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@](=O)(O)OC[…
|
| ZINC14880760 | 0.795 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@](=O)(O)OC[C…
|
| ZINC53683910 | 0.795 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[…
|
| ZINC62592202 | 0.795 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[C@…
|
| ZINC62592203 | 0.795 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC[C…
|
| ZINC62592204 | 0.795 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC…
|
| ZINC96094841 | 0.795 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC[C…
|
| ZINC102190506 | 0.729 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCCN)OC(=O)CC…
|
| ZINC102190512 | 0.729 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)C…
|
| ZINC25725098 | 0.717 | 438.5 Da LogP -2.79 TPSA 178.5 | 2 viol. | ✓ Clean |
OC[C@H]1O[C@H](O[C@@H]2[C@@H](CO)O[C@@H](OCC3CC…
|
| ZINC36178999 | 0.711 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC36179002 | 0.711 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC27416437 | 0.708 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCCN)OC(=O)CCCCC
|
| ZINC33902364 | 0.708 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)CCC…
|
| ZINC13543394 | 0.694 | 455.4 Da LogP 2.15 TPSA 171.7 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](N)C(=O)…
|
| ZINC5820131 | 0.689 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC5820134 | 0.689 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC13544781 | 0.686 | 482.6 Da LogP 4.22 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@@H](CO[P@](=O)(O)OCC[N+](C)(C)C…
|
| ZINC13544783 | 0.686 | 482.6 Da LogP 4.22 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)…
|
| ZINC100053689 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H]…
|
| ZINC100053691 | 0.681 | 496.6 Da LogP -0.84 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCCO[C@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC1501015302 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC2039285652 | 0.681 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2039285653 | 0.681 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2039285654 | 0.681 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2039285655 | 0.681 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2053493146 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H]…
|
| ZINC2053493147 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H]…
|
| ZINC2053493148 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H]…
|
| ZINC238809244 | 0.681 | 510.6 Da LogP -0.45 TPSA 178.5 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C…
|
| ZINC238809245 | 0.681 | 510.6 Da LogP -0.45 TPSA 178.5 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C…
|
| ZINC252695223 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC252695224 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC252695225 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC252695226 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC58649715 | 0.681 | 496.6 Da LogP -0.84 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC59978443 | 0.681 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H](…
|
| ZINC70669940 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC70669941 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC70669942 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC70669943 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC77311968 | 0.681 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@@H]2O[C@H]…
|
| ZINC83433913 | 0.681 | 426.5 Da LogP -2.79 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H](CO…
|
| ZINC85482724 | 0.681 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC86002923 | 0.681 | 426.5 Da LogP -2.79 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCO[C@@H]1O[C@H](CO)[C@H](O[C@H]2O[C@H](CO)…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.