Overview
Basic information about this protein and its source genome.
- Accession
- PA5389
- Gene
- cdhR PA5389
- Status
- annotated
- Amino acids
- 336
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSQDFWFLLLPGFSVMGFVSAVEPLRVANRFHADLYRWHVLSADGGPVLASNGMSVNSDGALEPLKKGDLLFVVAGFEPLRAVTPALVQWLRKLDRNGVTLGGIDTGSVVLAEAGLLDGRRATLHWEAIDAFQESYPQLSVTQELFEIDGPRITSAGGTASIDLMLDLIAQAHGPQLAVQVSEQFVLGRIRPRQDHQRLQVATRYGVSNRKLVQVIGEMERHTEPPLTTLELAERIQVTRRQLERLFRVHLDDTPSNFYLGLRLDKARQLLRQTDLSVLQVSLACGFESPSYFSRSYRARFAASPSQDRAVLPLKAPAATPPGAPAGHRTPRAERG
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
4- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
- GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
- GO:0009896 Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of substances.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 206 | 311 | FunFam | G3DSA:1.10.10.60:FF:000090 | Transcriptional regulator ArgR, AraC family |
| 1 | 21 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 226 | 309 | SMART | SM00342 | aracneu4 |
| 226 | 309 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 263 | 305 | ProSitePatterns | PS00041 | Bacterial regulatory proteins, araC family signature. |
| 263 | 305 | InterPro | IPR018062 | HTH domain AraC-type, conserved site |
| 5 | 16 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 5 | 188 | CDD | cd03136 | GATase1_AraC_ArgR_like |
| 213 | 311 | ProSiteProfiles | PS01124 | Bacterial regulatory proteins, araC family DNA-binding domain profile. |
| 213 | 311 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 200 | 311 | Gene3D | G3DSA:1.10.10.60 | - |
| 4 | 248 | PANTHER | PTHR43130 | ARAC-FAMILY TRANSCRIPTIONAL REGULATOR |
| 310 | 336 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 19 | 171 | Pfam | PF01965 | DJ-1/PfpI family |
| 19 | 171 | InterPro | IPR002818 | DJ-1/PfpI |
| 2 | 199 | Gene3D | G3DSA:3.40.50.880 | - |
| 2 | 199 | InterPro | IPR029062 | Class I glutamine amidotransferase-like |
| 17 | 21 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 232 | 309 | Pfam | PF12833 | Helix-turn-helix domain |
| 232 | 309 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 1 | 21 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 22 | 336 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 4 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 5 | 190 | SUPERFAMILY | SSF52317 | Class I glutamine amidotransferase-like |
| 5 | 190 | InterPro | IPR029062 | Class I glutamine amidotransferase-like |
| 262 | 310 | SUPERFAMILY | SSF46689 | Homeodomain-like |
| 262 | 310 | InterPro | IPR009057 | Homeobox-like domain superfamily |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA5389
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.728 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1710230 | 1.000 | 207.3 Da LogP 0.80 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCNC1CCCCC1
|
| ZINC2004372 | 0.786 | 221.3 Da LogP 1.19 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCNC1CCCCC1
|
| ZINC38364153 | 0.786 | 235.3 Da LogP 1.58 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCNC1CCCCC1
|
| ZINC1532902 | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC2018106 | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@](O)(CC(=O)O)C(=O)O
|
| ZINC100349549 | 0.667 | 272.2 Da LogP 3.92 TPSA 111.0 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N\c2ccc([N+](=O)[O-])cc2)c…
|
| ZINC13477308 | 0.667 | 272.2 Da LogP 3.92 TPSA 111.0 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N/c2ccc([N+](=O)[O-])cc2)c…
|
| ZINC3593496 | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC3593497 | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC14686440 | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=O…
|
| ZINC14686442 | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@](O)(CC(=O…
|
| ZINC14686444 | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=…
|
| ZINC104039967 | 0.615 | 288.2 Da LogP 3.43 TPSA 124.7 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(N=[N+]([O-])c2ccc([N+](=O)[O-…
|
| ZINC13398039 | 0.577 | 234.2 Da LogP -0.38 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC2528012 | 0.577 | 234.2 Da LogP -0.38 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC100172111 | 0.571 | 227.2 Da LogP 4.01 TPSA 67.9 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N\c2ccccc2)cc1
|
| ZINC18084630 | 0.571 | 227.2 Da LogP 4.01 TPSA 67.9 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N/c2ccccc2)cc1
|
| ZINC254365173 | 0.571 | 227.2 Da LogP 4.01 TPSA 67.9 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(N=Nc2ccccc2)cc1
|
| ZINC146315135 | 0.560 | 204.2 Da LogP 0.86 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC146315336 | 0.560 | 204.2 Da LogP 0.86 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@](O)(CC(=O)O)C(=O)O
|
| ZINC19367005 | 0.560 | 224.4 Da LogP 2.83 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
C1CCC(NCCNC2CCCCC2)CC1
|
| ZINC26468763 | 0.559 | 243.3 Da LogP -1.35 TPSA 100.5 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCN[C@@H]1CCS(=O)(=O)C1
|
| ZINC26468770 | 0.559 | 243.3 Da LogP -1.35 TPSA 100.5 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCN[C@H]1CCS(=O)(=O)C1
|
| ZINC1850353 | 0.556 | 206.1 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC(O)(CC(=O)O)CC(=O)O
|
| ZINC5188799 | 0.556 | 280.5 Da LogP 4.39 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
C(CCCNC1CCCCC1)CCNC1CCCCC1
|
| ZINC100009138 | 0.552 | 243.2 Da LogP 3.72 TPSA 88.1 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N\c2ccc(O)cc2)cc1
|
| ZINC100009140 | 0.552 | 243.2 Da LogP 3.72 TPSA 88.1 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N/c2ccc(O)cc2)cc1
|
| ZINC12405069 | 0.552 | 242.2 Da LogP 3.59 TPSA 93.9 | ✓ Ro5 | Alert |
Nc1ccc(N=Nc2ccc([N+](=O)[O-])cc2)cc1
|
| ZINC254392989 | 0.552 | 243.2 Da LogP 3.72 TPSA 88.1 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(N=Nc2ccc(O)cc2)cc1
|
| ZINC3861520 | 0.552 | 242.2 Da LogP 3.59 TPSA 93.9 | ✓ Ro5 | Alert |
Nc1ccc(/N=N/c2ccc([N+](=O)[O-])cc2)cc1
|
| ZINC4461716 | 0.552 | 241.3 Da LogP 4.32 TPSA 67.9 | ✓ Ro5 | Alert |
Cc1ccc(/N=N/c2ccc([N+](=O)[O-])cc2)cc1
|
| ZINC100838097 | 0.548 | 336.3 Da LogP 2.98 TPSA 145.1 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N/S(=O)(=O)c2ccc([N+](=O)[…
|
| ZINC1604377 | 0.542 | 320.3 Da LogP 4.84 TPSA 86.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(-c2ccc(-c3ccc([N+](=O)[O-])cc…
|
| ZINC1648209 | 0.542 | 244.2 Da LogP 3.17 TPSA 86.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(-c2ccc([N+](=O)[O-])cc2)cc1
|
| ZINC100480229 | 0.533 | 271.2 Da LogP 3.25 TPSA 98.6 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(/C=N\c2ccc([N+](=O)[O-])cc2)c…
|
| ZINC12403614 | 0.533 | 271.2 Da LogP 3.25 TPSA 98.6 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(/C=N/c2ccc([N+](=O)[O-])cc2)c…
|
| ZINC254391581 | 0.533 | 271.2 Da LogP 3.25 TPSA 98.6 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(C=Nc2ccc([N+](=O)[O-])cc2)cc1
|
| ZINC39239102 | 0.533 | 214.2 Da LogP 1.95 TPSA 72.6 | ✓ Ro5 | ✓ Clean |
CS(C)(=O)=Nc1ccc([N+](=O)[O-])cc1
|
| ZINC2168583 | 0.529 | 237.3 Da LogP 0.16 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)C[C@@H](O)CNC1CCCCC1
|
| ZINC2168584 | 0.529 | 237.3 Da LogP 0.16 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)C[C@H](O)CNC1CCCCC1
|
| ZINC13398014 | 0.522 | 220.2 Da LogP -1.07 TPSA 110.1 | ✓ Ro5 | ✓ Clean |
COC(=O)CC(O)(CC(=O)OC)C(=O)O
|
| ZINC3861629 | 0.522 | 206.1 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C(O)(CC(=O)O)CC(=O)O
|
| ZINC130127586 | 0.515 | 260.4 Da LogP 1.38 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=S(=O)(NCCNC1CCCCCC1)C1CC1
|
| ZINC78421079 | 0.515 | 210.3 Da LogP 1.43 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NCCNC1CCCCC1)C1CC1
|
| ZINC104075553 | 0.500 | 243.2 Da LogP 3.52 TPSA 81.6 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc([N+]([O-])=Nc2ccccc2)cc1
|
| ZINC1511626 | 0.500 | 249.0 Da LogP 2.20 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(I)cc1
|
| ZINC165485 | 0.500 | 301.8 Da LogP 3.04 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=S(=O)(CCNC1CCCCC1)c1ccc(Cl)cc1
|
| ZINC17005675 | 0.500 | 257.2 Da LogP 4.02 TPSA 77.1 | ✓ Ro5 | Alert |
COc1ccc(/N=N/c2ccc([N+](=O)[O-])cc2)cc1
|
| ZINC4113982 | 0.500 | 270.3 Da LogP 4.08 TPSA 71.1 | ✓ Ro5 | Alert |
CN(C)c1ccc(/N=N/c2ccc([N+](=O)[O-])cc2)cc1
|
| ZINC60934954 | 0.500 | 315.9 Da LogP 3.43 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=S(=O)(CCNC1CCCCCC1)c1ccc(Cl)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.