Protein target profile

PA5393

hypothetical protein

Genome: NC_002516.2

Gene: PA5393 3D evidence: AlphaFold DB model UniProt Q9HTH1
Length 450
Pocket druggability 0.71
EC / GO 0 / 2
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

3 signals
How to read this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Overview

Basic information about this protein and its source genome.

Accession
PA5393
Gene
PA5393
Status
annotated
Amino acids
450
3D evidence
AlphaFold DB model

Target profile

Computed evidence for target prioritization.

Human off-target
Hit
Human identity (%)
26.794
Human E-value
2.37e-07
Gut microbiome off-target
Hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected pocket evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.71
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTDLNRTALPSRTDGTVEKTDTLVVGAGQAGVAMSEHLSRLGVPHLVLERNRIAEAWRSGRWDSLVANGPAWHDRFPGMEFDIDPDGFPGKDQVAAYFEAYAKRFDAPIRTGVEVRKVVRNVGRPGFTVDTSAGTIEANRVVAATGPFQRPVIPPIAPRDERIRQIHSAHYYNPQQLPEGAVLVVGAGSSGVQIADELQRAGRQVYLSVGAHDRPPRSYRNRDFCWWLGVLGEWDAEVAKPGREHVTIAVSGARGGHTVDFRALAHQGVTLVGLTESFVDGVATFRPDLAENLARGDENYLALLDAADAYIARNGLDLPEEPEARRRLPDPQCVTDPILELDLAEAGVGSIIWATGYAVDFGWLQVDAFDRDGKPRHQRGVSSEPGVYFIGLPWLSRRGSSFIWGVWHDARHVADHIAIQRKYLAYRDAAQRQEQDRASQAPQTSLQEVS

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0050660 Binding to FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
  • GO:0004497 Catalysis of the incorporation of one atom of molecular oxygen (O2) into the substrate and the reduction of the other atom of O2 to water.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
20 429 PANTHER PTHR43539 FLAVIN-BINDING MONOOXYGENASE-LIKE PROTEIN (AFU_ORTHOLOGUE AFUA_4G09220)
182 418 SUPERFAMILY SSF51905 FAD/NAD(P)-binding domain
182 418 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
22 41 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
181 199 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
19 233 SUPERFAMILY SSF51905 FAD/NAD(P)-binding domain
19 233 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
21 43 PRINTS PR00411 Pyridine nucleotide disulphide reductase class-I signature
181 206 PRINTS PR00411 Pyridine nucleotide disulphide reductase class-I signature
141 150 PRINTS PR00411 Pyridine nucleotide disulphide reductase class-I signature
316 427 Gene3D G3DSA:3.50.50.60 -
316 427 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
16 295 Gene3D G3DSA:3.50.50.60 -
16 295 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
23 211 Pfam PF13738 Pyridine nucleotide-disulphide oxidoreductase

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB PA5393
AlphaFold DB full sequence Viewing
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.71
Show in viewer