Protein profile
PA5413
low specificity l-threonine aldolase
Genome: NC_002516.2
Overview
Basic information about this protein and its source genome.
- Accession
- PA5413
- Gene
- ltaA
- Status
- annotated
- Amino acids
- 346
- Structure source
- ColabFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTDHTQQFASDNYSGICPEAWAAMAEANRGHERAYGDDQWTARASDYFRQLFETDCEVFFAFNGTAANSLALAALCQSYHSVICSETAHVETDECGAPEFFSNGSKLLLAQTEVGKLTPASIRDIALKRQDIHYPKPRVVTLTQATEVGTVYRPDELKAISATCKELGLHLHMDGARFSNACAFLGCSPAELSWKAGVDVLCFGGTKNGMAVGEAILFFNRDLAEDFDYRCKQAGQLASKMRFLAAPWVGVLQDDAWLRYADHANRCARLLAELVADVPGVSLMFPVEANGVFLQLSEPAIEALRARGWRFYTFIGEGGARFMCSWDTDIERVRELARDIRLVMGA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
5- GO:0016829 Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
- GO:0006520 The chemical reactions and pathways involving amino acids, carboxylic acids containing one or more amino groups.
- GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
- GO:0006567 The chemical reactions and pathways resulting in the breakdown of L-threonine.
- GO:0004793 Catalysis of the reaction: L-threonine = glycine + acetaldehyde.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 346 | PIRSF | PIRSF038940 | Low_specificity_LTA |
| 5 | 346 | InterPro | IPR026273 | Low specificity L-threonine aldolase, bacteria |
| 4 | 343 | PANTHER | PTHR48097 | L-THREONINE ALDOLASE-RELATED |
| 7 | 341 | SUPERFAMILY | SSF53383 | PLP-dependent transferases |
| 7 | 341 | InterPro | IPR015424 | Pyridoxal phosphate-dependent transferase |
| 9 | 336 | Gene3D | G3DSA:3.90.1150.10 | Aspartate Aminotransferase, domain 1 |
| 9 | 336 | InterPro | IPR015422 | Pyridoxal phosphate-dependent transferase, small domain |
| 7 | 343 | CDD | cd06502 | TA_like |
| 17 | 255 | Gene3D | G3DSA:3.40.640.10 | - |
| 17 | 255 | InterPro | IPR015421 | Pyridoxal phosphate-dependent transferase, major domain |
| 17 | 255 | FunFam | G3DSA:3.40.640.10:FF:000087 | L-threonine aldolase |
| 7 | 297 | Pfam | PF01212 | Beta-eliminating lyase |
| 7 | 297 | InterPro | IPR001597 | Aromatic amino acid beta-eliminating lyase/threonine aldolase |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
ColabFold
PA5413
|
ColabFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 3 | 0.746 | ||||||
| 4 | 0.351 | ||||||
| 6 | 0.322 | ||||||
| 1 | 0.224 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| PLG | O07051 | 306.2 Da LogP -0.12 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
Cc1c(c(c(cn1)COP(=O)(O)O)CNCC(=O)O)O
|
|
| PLR | A0A166JNM8 | 233.2 Da LogP 1.01 TPSA 99.9 | ✓ Ro5 | ✓ Clean |
Cc1c(cnc(c1O)C)COP(=O)(O)O
|
|
| TLP | Q9X266 | 350.3 Da LogP -0.37 TPSA 169.4 | 1 viol. | ✓ Clean |
Cc1c(c(c(cn1)COP(=O)(O)O)CNC(C(C)O)C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1656021 | 1.000 | 233.2 Da LogP 1.01 TPSA 99.9 | ✓ Ro5 | ✓ Clean |
Cc1ncc(COP(=O)(O)O)c(C)c1O
|
| ZINC1532708 | 0.674 | 248.2 Da LogP 0.16 TPSA 125.9 | ✓ Ro5 | ✓ Clean |
Cc1ncc(COP(=O)(O)O)c(CN)c1O
|
| ZINC1532705 | 0.652 | 249.2 Da LogP 0.20 TPSA 120.1 | ✓ Ro5 | ✓ Clean |
Cc1ncc(COP(=O)(O)O)c(CO)c1O
|
| ZINC1532514 | 0.583 | 247.1 Da LogP 0.52 TPSA 117.0 | ✓ Ro5 | ✓ Clean |
Cc1ncc(COP(=O)(O)O)c(C=O)c1O
|
| ZINC2114966 | 0.534 | 332.2 Da LogP 0.99 TPSA 149.5 | ✓ Ro5 | ✓ Clean |
Cc1ncc(COP(=O)(O)O)c(/C=N/CCCC(=O)O)c1O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.