Protein profile

PA5419

sarcosine oxidase subunit gamma

Genome: NC_002516.2

Gene: PA5419 soxG Structure source: AlphaFold UniProt Q9HTE5
Export view
Amino acids 211
Annotations 3
Features 9
PDB binders 0
Druggability 0.685

Overview

Basic information about this protein and its source genome.

Accession
PA5419
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA5419 soxG
Status
annotated
Amino acids
211
Structure source
AlphaFold
GO
GO:0008115 Catalysis of the reaction: H2O + O2 + sarcosine = formaldehyde + glycine + H2O2. GO:1901053 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of sarcosine. GO:0005515 Binding to a protein.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.685
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSKANVYQQRPEPGVHAESPLHHAELHKLAGKTAAKAGIVLREKKLLGHLVLRGDAADPAFAAAVHQALGLELPVALTLVASGETSLQWLAPDEWLLIVPGGEEYAVEQRLRQALGEELHYAVVNVSGGQTLLELSGANVRELLMKSTSYDVHPSNFPVGKAVGSIFAKSQCVIRHTGEDTWELVVRRSFADYFWLWLQDASAEYGLQVAA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0008115 Catalysis of the reaction: H2O + O2 + sarcosine = formaldehyde + glycine + H2O2.
  • GO:1901053 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of sarcosine.
  • GO:0005515 Binding to a protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

9 records
Show feature table
Start End DB Term Name
38 205 Gene3D G3DSA:3.30.1360.120 Probable tRNA modification gtpase trme; domain 1
38 205 InterPro IPR027266 GTP-binding protein TrmE/Aminomethyltransferase GcvT, domain 1
84 209 SUPERFAMILY SSF103025 Folate-binding domain
1 21 MobiDBLite mobidb-lite consensus disorder prediction
46 127 Gene3D G3DSA:3.30.70.1520 Heterotetrameric sarcosine oxidase
53 204 Pfam PF04268 Sarcosine oxidase, gamma subunit family
53 204 InterPro IPR007375 Sarcosine oxidase, gamma subunit
52 204 NCBIfam TIGR01375 sarcosine oxidase subunit gamma family protein
52 204 InterPro IPR006280 Sarcosine oxidase, gamma subunit, heterotetrameric

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA5419
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
3 0.685
2 0.682
1 0.542
7 0.363