Protein profile

PA5420

formyltetrahydrofolate deformylase

Genome: NC_002516.2

Gene: PA5420 purU2 purU Structure source: AlphaFold UniProt Q9HTE4
Amino acids 285
Annotations 5
Features 26
PDB binders 23
Druggability 0.697

Overview

Basic information about this protein and its source genome.

Accession
PA5420
Gene
PA5420 purU2 purU
Status
annotated
Amino acids
285
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
33.333
Human E-value
1.5e-15
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.697
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSRTPDTWILTADSPSLLGTVDVVTRYLFEQRCYVTEHHSFDDRLAQRFFIRVEFRAGDGFDEASFRAGLAERVAPFGMRTELTAPGYRSQVAIMVSKADHCLNDLLYRQRIGQLPMDVVAVISNHPDLEPLARWHGIPYHHFPLDPNDKPAQEARVWQVLEESGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYQKGVKLVGATAHYINNDLDEGPIIAQGVETVDHAHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0008864 Catalysis of the reaction: 10-formyltetrahydrofolate + H2O = (6S)-5,6,7,8-tetrahydrofolate + formate + H+.
  • GO:0006189 The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
  • GO:0006730 The chemical reactions and pathways involving the transfer of one-carbon units in various oxidation states.
  • GO:0009058 A cellular process consisting of the biochemical pathways by which a living organism synthesizes chemical substances. This typically represents the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

Sequence Features

Domain/signature hits from InterPro and related databases.

26 records
Show feature table
Start End DB Term Name
5 285 PANTHER PTHR42706 FORMYLTETRAHYDROFOLATE DEFORMYLASE
5 285 InterPro IPR004810 Formyltetrahydrofolate deformylase
92 285 CDD cd08648 FMT_core_Formyl-FH4-Hydrolase_C
92 285 InterPro IPR041729 Formyltetrahydrofolate deformylase, C-terminal hydrolase domain
1 87 Gene3D G3DSA:3.30.70.260 -
113 140 PRINTS PR01575 Formyltetrahydrofolate deformylase signature
113 140 InterPro IPR004810 Formyltetrahydrofolate deformylase
91 113 PRINTS PR01575 Formyltetrahydrofolate deformylase signature
91 113 InterPro IPR004810 Formyltetrahydrofolate deformylase
10 36 PRINTS PR01575 Formyltetrahydrofolate deformylase signature
10 36 InterPro IPR004810 Formyltetrahydrofolate deformylase
42 54 PRINTS PR01575 Formyltetrahydrofolate deformylase signature
42 54 InterPro IPR004810 Formyltetrahydrofolate deformylase
237 259 PRINTS PR01575 Formyltetrahydrofolate deformylase signature
237 259 InterPro IPR004810 Formyltetrahydrofolate deformylase
259 284 PRINTS PR01575 Formyltetrahydrofolate deformylase signature
259 284 InterPro IPR004810 Formyltetrahydrofolate deformylase
5 285 PIRSF PIRSF036480 FormyFH4_hydr
5 285 Hamap MF_01927 Formyltetrahydrofolate deformylase [purU].
9 79 CDD cd04875 ACT_F4HF-DF
9 79 InterPro IPR044074 Formyltetrahydrofolate deformylase, ACT domain
90 285 Gene3D G3DSA:3.40.50.170 -
91 266 Pfam PF00551 Formyl transferase
91 266 InterPro IPR002376 Formyl transferase, N-terminal
92 284 SUPERFAMILY SSF53328 Formyltransferase
92 284 InterPro IPR036477 Formyl transferase, N-terminal domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA5420
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.697

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

148 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
138 P08179 752.6 Da LogP -2.34 TPSA 353.5 3 viol. ✓ Clean c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)[C@@](Cc2…
3YA P22102 472.5 Da LogP 2.18 TPSA 175.5 ✓ Ro5 ✓ Clean c1cc(ccc1CCCCc2cc3c(s2)NC(=NC3=O)N)C(=O)N[C@@H]…
3YB P22102 461.5 Da LogP 1.51 TPSA 191.3 1 viol. ✓ Clean c1c(csc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)CCCCc2cc3c…
3YC P22102 461.5 Da LogP 1.51 TPSA 191.3 1 viol. ✓ Clean c1c(csc1CCCCc2cc3c([nH]2)N=C(NC3=O)N)C(=O)N[C@@…
3YD P22102 407.4 Da LogP 0.76 TPSA 191.3 1 viol. ✓ Clean c1c([nH]c2c1C(=O)NC(=N2)N)CCCCCCC(=O)N[C@@H](CC…
3YE P22102 421.5 Da LogP 1.15 TPSA 191.3 1 viol. ✓ Clean c1c([nH]c2c1C(=O)NC(=N2)N)CCCCCCCC(=O)N[C@@H](C…
3YF P22102 447.5 Da LogP 1.12 TPSA 191.3 1 viol. ✓ Clean c1c(csc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)CCCc2cc3c(…
3YG P22102 447.5 Da LogP 1.12 TPSA 191.3 1 viol. ✓ Clean c1c(csc1CCCc2cc3c([nH]2)N=C(NC3=O)N)C(=O)N[C@@H…
4DW P22102 425.4 Da LogP 0.44 TPSA 191.3 1 viol. ✓ Clean c1cc(ccc1CCc2c[nH]c3c2C(=O)N=C(N3)N)C(=O)N[C@@H…
83A P22102 442.4 Da LogP 0.54 TPSA 203.3 1 viol. ✓ Clean c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NCCc2cc3c…
DXZ P22102 477.5 Da LogP 1.41 TPSA 201.5 1 viol. ✓ Clean CS[C@H](CCCC1=C(N=C(NC1=O)N)N)c2ccc(cc2)C(=O)N[…
DZF P08179 440.4 Da LogP 0.56 TPSA 200.4 1 viol. ✓ Clean c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NCc2cc3c(…
FLC Q88LI9 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
G94 P22102 447.5 Da LogP 1.12 TPSA 191.3 1 viol. ✓ Clean c1cc(sc1CCCc2cc3c([nH]2)NC(=NC3=O)N)C(=O)N[C@@H…
GAR P22102 284.2 Da LogP -4.65 TPSA 177.2 ✓ Ro5 ✓ Clean C([C@@H]1[C@H]([C@H]([C@@H](O1)NC(=O)CN)O)O)OP(…
KEU P22102 549.5 Da LogP -0.91 TPSA 237.3 2 viol. ✓ Clean c1cc(ccc1[C@@H](CCCC2C(NC(NC2=O)N)N)C(C(F)(F)F)…
KT3 P22102 803.7 Da LogP -0.56 TPSA 375.0 3 viol. ✓ Clean c1cc(ccc1[C@H](CCCc2c(nc(nc2O)N)N)C(C(F)(F)F)(O…
KT5 P22102 1061.9 Da LogP -1.86 TPSA 507.8 3 viol. ✓ Clean c1cc(ccc1[C@H](CCCc2c(nc(nc2O)N)N)C(C(F)(F)F)(O…
NHE Q83AY9 207.3 Da LogP 0.80 TPSA 66.4 ✓ Ro5 ✓ Clean C1CCC(CC1)NCCS(=O)(=O)O
NHR P08179 482.4 Da LogP 1.38 TPSA 213.0 1 viol. ✓ Clean c1cc(ccc1[C@@H](Cc2ccc3c(c2)c(nc(n3)N)O)C(=O)O)…
NHS P08179 482.4 Da LogP 0.96 TPSA 212.8 1 viol. ✓ Clean c1cc(ccc1[C@H](Cc2ccc3c(c2)C(=O)NC(=N3)N)C(=O)O…
U89 P08179 715.7 Da LogP -0.31 TPSA 317.7 3 viol. ✓ Clean c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)N(CCCC2=C…
V97 P22102 478.6 Da LogP 2.24 TPSA 175.5 ✓ Ro5 ✓ Clean c1cc(sc1CCCCc2cc3c(s2)N=C(NC3=O)N)C(=O)N[C@@H](…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.