Protein profile

PA5481

hypothetical protein

Genome: NC_002516.2

Gene: PA5481 Structure source: AlphaFold UniProt Q9HT89
Export view
Amino acids 155
Annotations 2
Features 13
PDB binders 0
Druggability 0.646

Overview

Basic information about this protein and its source genome.

Accession
PA5481
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA5481
Status
annotated
Amino acids
155
Structure source
AlphaFold
GO
GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria). GO:0043086 Any process that stops or reduces the activity of an enzyme.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.646
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MRLMRNLMNALLLGAAASSLAVAADRDGEYRLNELQSTDAGYRKAWQNLVEDESRLPDWVMNLSGTATPMHAVDDQGDKYLVGGLCEKSDCKGQRLLVAFDWDKSHAYGLYVQVPEGLPQDKSPSKHASFRWLGKPEPAVQKILDEQLKADPNWY

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
  • GO:0043086 Any process that stops or reduces the activity of an enzyme.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
27 155 SUPERFAMILY SSF89872 Inhibitor of vertebrate lysozyme, Ivy
27 155 InterPro IPR036501 Inhibitor of vertebrate lysozyme superfamily
38 153 Pfam PF08816 Inhibitor of vertebrate lysozyme (Ivy)
1 155 PIRSF PIRSF009103 Ivy
1 155 InterPro IPR014453 Inhibitor of vertebrate lysozyme
1 23 SignalP_EUK SignalP-noTM SignalP-noTM
24 155 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 23 Phobius SIGNAL_PEPTIDE Signal peptide region
1 23 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
10 18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
27 155 Gene3D G3DSA:3.40.1420.10 Inhibitor of vertebrate lysozyme
1 9 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
19 23 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA5481
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.646