Protein profile

PA5513

hypothetical protein

Genome: NC_002516.2

Gene: PA5513 poxA Structure source: AlphaFold UniProt Q6PLK7 UniProt Q9HT60
Amino acids 292
Annotations 0
Features 7
PDB binders 6
Druggability 0.709

Overview

Basic information about this protein and its source genome.

Accession
PA5513
Gene
PA5513 poxA
Status
annotated
Amino acids
292
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.709
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSLSPWFHSCSAGFTLRGWRSEPSGKPLLHFLHGNGFCGRTYEPMLRLLAEDFDLWLCDIQGHGESDHGGRFHGWNRNAEMAVEAFEAGRGPYGDVQRLACGHSFGGVLSSLVLARHPTLFARAVLLDPVLFTPAMIGVMALSETLGLQLRGSLAKKARLRRSQWPDRAAAYAGLRGRGIFKGWTDEALWAYVEYALKESDGGVELKCRPSREAEIFSSFPRRLWPSLGKITTPTRVLYGDRTYPFVAKSVARWCSLNPQVSAHVVVGGHCFMQEDPADAAERVRDFLLPNP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

7 records
Show feature table
Start End DB Term Name
11 288 SUPERFAMILY SSF53474 alpha/beta-Hydrolases
11 288 InterPro IPR029058 Alpha/Beta hydrolase fold
21 288 PANTHER PTHR43248 2-SUCCINYL-6-HYDROXY-2,4-CYCLOHEXADIENE-1-CARBOXYLATE SYNTHASE
31 282 Pfam PF12697 Alpha/beta hydrolase family
31 282 InterPro IPR000073 Alpha/beta hydrolase fold-1
15 289 Gene3D G3DSA:3.40.50.1820 alpha/beta hydrolase
15 289 InterPro IPR029058 Alpha/Beta hydrolase fold

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA5513
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.709

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

156 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
9JX Q99685 467.0 Da LogP 4.03 TPSA 56.8 ✓ Ro5 ✓ Clean c1ccc(c(c1)c2cccc(c2)N3C[C@@H](CC3=O)N4CCN(CC4)…
E3A Q99685 384.4 Da LogP 1.86 TPSA 84.7 ✓ Ro5 ✓ Clean c1cc(ccc1n2ccc(n2)C3[C@H]4[C@@H]3CN(C4)C(=O)ON5…
F4P Q99685 383.4 Da LogP 2.93 TPSA 54.3 ✓ Ro5 ✓ Clean c1cc(ccc1C(c2ccc(cc2)F)N3CCN(CC3)C(=O)n4cncn4)F
XOV Q99685 396.8 Da LogP 2.99 TPSA 67.9 ✓ Ro5 ✓ Clean c1cc(c(cc1F)Cl)OCC2CCN(CC2)C(=O)C3CC4(C3)COC(=O…
XP7 Q99685 382.9 Da LogP 3.16 TPSA 58.6 ✓ Ro5 ✓ Clean c1cc(c(cc1F)Cl)OCC2CCN(CC2)C(=O)CC[C@@H]3CCC(=O…
XPD Q99685 418.9 Da LogP 3.74 TPSA 67.9 ✓ Ro5 ✓ Clean c1cc2c(cc1C(=O)N3CCC(CC3)COc4ccc(cc4Cl)F)NC(=O)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.